(data stored in ACNUC7421 zone)

EMBL: AP009493.PE183

AP009493.PE183       Location/Qualifiers
FT   CDS_pept        complement(184897..185169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_183"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17012"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI9"
FT                   /protein_id="BAG17012.1"
FT                   /translation="MQSAPGLLPRRQFPGCDWSGRRGRVLGKADLDDALPGELPAGRGG
FT                   VLEPRYSPRMVSPFPAQWTAHRSSESLSLCVPLRQSRVVTSPWGR"
     gtgcagagcg ctcccggcct cctgccacgg cggcagtttc ccgggtgcga ctggtcgggc        60
     cgcagaggcc gcgtactggg taaggccgac ctcgatgacg cgctccccgg ggagctgccc       120
     gctgggcgcg gtggggtctt ggagccgagg tattcgccgc ggatggtttc cccgttcccg       180
     gcccagtgga ctgcacaccg ctcctcggag tccttgtcac tttgcgtgcc gctgaggcag       240
     tcccgggtgg tcacgagtcc atggggccgg tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page