(data stored in ACNUC7421 zone)

EMBL: AP009493.PE184

AP009493.PE184       Location/Qualifiers
FT   CDS_pept        185537..185836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_184"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17013"
FT                   /db_xref="InterPro:IPR005528"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ0"
FT                   /protein_id="BAG17013.1"
FT                   /translation="MELTMNRETRNTGARAIVLGAVAGAALLPAGTAEANVVGVGNAAF
FT                   GNTCANQADTRAEGATVAGSGLGSGNHAGLPLNLARNHCGNSGIICTALFMARY"
     atggagttga cgatgaacag ggaaacgcgg aacaccggtg cgcgggccat cgtgctgggg        60
     gcggtcgccg gggcggcact gctccccgca gggacggccg aggcgaacgt cgtcggcgtc       120
     gggaacgcag cgttcggcaa cacgtgcgcg aaccaggccg atacacgcgc cgagggagcc       180
     accgtcgccg gaagcggcct gggcagcggc aaccacgccg ggctgcccct gaacctggca       240
     cgcaaccact gcggcaacag cggcatcatc tgcaccgccc tcttcatggc gcggtactga       300
//

If you have problems or comments...

PBIL Back to PBIL home page