(data stored in ACNUC7421 zone)

EMBL: AP009493.PE185

AP009493.PE185       Location/Qualifiers
FT   CDS_pept        185883..187124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_185"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17014"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ1"
FT                   /protein_id="BAG17014.1"
FT                   /translation="MMAAGTSTTGVRVGDRAVAEFLALGGQTLPLLRNWAGEEPGNGVA
FT                   RGLLTLATSERMDDRVLKQQLVTAHRDAQASGEREASLVYGVFLHTHRQYRLTADHLMA
FT                   HFERWPTDEVATLILDAFSAAGDSAYRVHGDALVEQQATLAGPDSWVWASCLAAVRAEQ
FT                   GRVREAHRLAEHALSRNPRSGVAVHALAHVEHELGTGPASTRMLDRWLAQDSQAVQLGH
FT                   LNWHAALQSIACGDFADARHRADTALRREDVGMRAATNWRLMLVGQEPARRSDLDHVRE
FT                   LLAAPGGMAEVFHTFNLALALAVEAATEDLETLAGRAAADPRPAYREVLAPVVGALAHI
FT                   TVGHPRAAAEGLAALGEKAEQIGGVRVEREIVQDTLARALIDAGDPARAAALLRHRTTT
FT                   RDHHTYENLLLAPR"
     atgatggcag cgggcacgtc gacaaccggc gtgcgggttg gtgaccgggc agtggccgag        60
     ttcctggcct tgggcgggca gacgctgccg ctgctgcgga actgggcggg cgaggaaccc       120
     ggcaacggtg tggcgcgcgg cctgctcacc ctcgcgacgt ccgagcggat ggacgacagg       180
     gtcctcaaac agcagctggt gaccgcccac cgtgacgcgc aagcctcggg tgagcgggag       240
     gcgagtctgg tatatggggt gttcctgcac actcaccggc agtaccggct gaccgccgac       300
     catctgatgg cgcacttcga gcgctggcca acggacgagg tcgcgacact gatactggat       360
     gccttctccg ccgcagggga ctccgcatac cgcgtgcacg gagatgccct ggtggagcag       420
     caggcgacgc tcgcggggcc ggacagctgg gtgtgggcga gctgtctcgc cgcggtcaga       480
     gccgagcagg gccgggtacg tgaagcgcac cgactcgccg aacacgcact gtcccgcaac       540
     ccccgctcgg gagtggccgt gcacgccctc gcccacgtcg agcacgaact cggcacgggc       600
     ccggcatcca ccaggatgct ggaccggtgg ttggcccagg actcccaggc cgtgcaactg       660
     gggcacctga actggcacgc cgctctgcag tccatcgcct gcggagactt cgccgacgcc       720
     cggcaccggg ccgatacggc gttgcggcgt gaggacgtgg gcatgcgggc ggcgacgaac       780
     tggcgtttga tgctggtggg ccaggagccc gcccgtcgca gcgacctgga tcacgtgcgg       840
     gaactgctgg cagcgccggg cggcatggcc gaggtcttcc acaccttcaa ccttgccctg       900
     gccctcgcgg tggaagccgc gaccgaggac ctggagacgc tggccggccg ggctgccgcc       960
     gatccgcgcc ccgcttaccg cgaagtcctg gcccccgtcg tgggggcgct ggcccacata      1020
     acagtcggcc acccacgtgc cgcggccgaa ggccttgccg ctctcggtga gaaagccgaa      1080
     cagatcggcg gagtccgcgt ggagcgggag atcgtccagg acacactcgc ccgcgctctc      1140
     atcgacgccg gcgaccccgc ccgcgcagcc gcactgctcc ggcaccgcac caccacccgt      1200
     gaccaccaca cctacgagaa cctgctcctg gccccacgct ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page