(data stored in ACNUC7421 zone)

EMBL: AP009493.PE187

AP009493.PE187       Location/Qualifiers
FT   CDS_pept        complement(191655..192026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_187"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17016"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ3"
FT                   /protein_id="BAG17016.1"
FT                   /translation="MQERRLDDLLVRITEYTRPNACVLALLGSTGAWNTPALEHAFHAA
FT                   AATERPLVVDLTGLDFGDEVLLGILVQAHASLRGLVLVNPATGSFARRLHRTGVEELFN
FT                   TQSTLPLALAQLPSSPHPR"
     atgcaggaac gccgactcga cgatctgctg gtcaggatca ccgagtacac ccgtccgaac        60
     gcctgcgtcc tggctctgct cggcagcacc ggagcatgga acacacctgc gctggagcac       120
     gcattccacg ccgccgcggc gacggagcgt ccgctcgtgg tcgacctcac cggcctggac       180
     ttcggggacg aagtccttct cggcatcctc gtccaggctc acgcctccct ccgcggtctc       240
     gtcctggtca accccgccac cggttccttc gcccgccgcc tgcaccggac cggcgtcgaa       300
     gaactcttca acacccagag caccctgccc ctcgccctgg cccaactgcc cagcagcccc       360
     catccccggt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page