(data stored in ACNUC7421 zone)

EMBL: AP009493.PE188

AP009493.PE188       Location/Qualifiers
FT   CDS_pept        complement(192112..193500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_188"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17017"
FT                   /db_xref="GOA:B1VNJ4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ4"
FT                   /protein_id="BAG17017.1"
FT                   /translation="MVGWLAGSCGEPRKEGGLLGGVEYPEGVRDDGLPAVLSDPARLAS
FT                   LEASGMVGSAPEQVFDDLTRLAVSVTGAAISAITFVGGARTYWKSVPHLPYGGSEQWQN
FT                   GVGESFCYFAVGANGPFIVEDAAKDPRTAGHQGIGPWGVGSWAGFPIVTTDGHAIGTMC
FT                   VIDANPRQWKPQELETLATLARAVSNEINLRISLSTAQSALATANAALSVSQDLARSLQ
FT                   ESLLPPVLRPVPGMDASARYLAATGDVEVVGDFYDLFNARGPWWTAVMGDVCGKGLEAA
FT                   KVTALARYTLRADAGDHLSPAEVLDRLNSAMRAQRAPRFLTAVQATFRTTPAGAAGRLC
FT                   LAGHPPALIRRADGRVQQTGLPGTLLGVMPTVSLSDVRFRLAPGDLLFLYTDGACEARP
FT                   DPSKPLPHRPIFDEEALAEALADTRGMDAADTNAHIAEVLAGHHGGWASDDTALLSLRV
FT                   PPRP"
     gtggttgggt ggctcgcggg ctcctgcggg gagccgagga aagagggcgg gttgttgggt        60
     ggggtggagt atcccgaggg ggtgcgggat gacgggctgc cggcggtgtt gtccgacccc       120
     gcgcggctgg cctcactgga ggccagtggc atggtcggca gcgctccgga gcaggtgttc       180
     gacgacctga ccaggctggc ggtgtcggtc actggtgcgg cgatctccgc gatcacgttc       240
     gtgggagggg cccggaccta ttggaaatcg gtgccacacc tgccgtacgg tgggtcggag       300
     cagtggcaga acggggtggg ggagagcttc tgctacttcg ccgtcggggc gaacggcccg       360
     ttcatcgtgg aggacgcggc gaaggacccc cgtacggcgg ggcatcaggg catcgggccg       420
     tggggggtcg gatcctgggc ggggttcccg atcgtcacca ccgacgggca cgccatcggg       480
     accatgtgcg tcatcgacgc gaacccccgc cagtggaagc cgcaggagct ggagacgctc       540
     gccactctgg cccgggcggt gtccaacgag atcaacctgc ggatctcgct gagcaccgcg       600
     cagagcgccc tggccactgc caacgcggcg ctgtcggtct cacaggatct ggcccgcagc       660
     cttcaggaaa gcctcttgcc cccggtcctg cgtccggtac cggggatgga tgcctcggcc       720
     cgctacctgg ctgccaccgg ggatgtcgag gtcgtgggtg acttctacga cctcttcaac       780
     gcccgcgggc cgtggtggac cgccgtgatg ggagacgtct gtggcaaggg gctcgaagcg       840
     gcgaaggtga ccgccctggc ccgctacacc ctgcgcgccg acgccggtga ccacctctcg       900
     cccgccgagg tcctggaccg gctcaacagc gccatgcgcg cccagcgcgc gccgcggttc       960
     ctcaccgccg tccaggcgac cttccgtacg acccctgccg gggcggccgg gcggctctgt      1020
     ctggccggcc atccccccgc actcatccgc cgggccgacg gccgcgtcca gcagaccggc      1080
     ctgcccggca cgctgctcgg ggtgatgccc accgtctccc tgtccgatgt ccgcttccgc      1140
     cttgcaccgg gtgacctgct gtttctctac accgacggtg cctgcgaggc ccgccccgac      1200
     cccagcaagc cccttccgca ccggccgatc ttcgacgagg aggccctcgc cgaagccctc      1260
     gccgataccc gcggcatgga cgcggcggac accaacgcgc acatcgccga ggttctggcc      1320
     ggtcaccacg gcggatgggc cagcgacgac accgccctcc tctccctgcg agtgccccca      1380
     agaccctga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page