(data stored in ACNUC7421 zone)

EMBL: AP009493.PE189

AP009493.PE189       Location/Qualifiers
FT   CDS_pept        complement(194789..195655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_189"
FT                   /product="putative glutamate transporter glutamate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_189"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17018"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ5"
FT                   /protein_id="BAG17018.1"
FT                   /translation="MVALAGAALAGCSSEPSSLLAEGKIEIGSKGDQPGTSYSPHDGEF
FT                   NGFDITVAREVLDRVGVKVKSSDFEGVLSKNRARALHDGDVQLVAATYSITEQRMKPTS
FT                   EGGDGLDFVGPYASTRQGVLVRTEEAKRYKNHSDLNGRLICVWEGTTSAAELKKPAYSL
FT                   IRTVDMTDAQECVKALKEKRVDALSTDQLILYGFMKDDPSITVAHALTFGPFNDYGIAM
FT                   AKGHREDCKKLQQALMDYAQSNDWDRDFQINLPLVPKKDRDEARPTDDEIERSSCLDRP
FT                   SNAKVDG"
     gtggtggccc ttgccggagc tgccctggcc ggctgctcct cggaaccctc gtcactgctc        60
     gccgagggca agatcgagat cggcagcaag ggcgatcagc cgggcacgag ctactcaccc       120
     cacgacggcg agttcaacgg gttcgacata acggtcgccc gggaggtgct cgacagggtg       180
     ggggtcaagg tcaagtcctc ggacttcgaa ggtgttctgt ccaagaaccg ggcccgcgcc       240
     ctgcacgacg gcgacgtcca gctcgtcgcg gccacctact cgatcacgga acagaggatg       300
     aagccgacgt cggaaggcgg cgacgggctg gacttcgtgg gcccctacgc gtccacccgg       360
     cagggcgttc tcgtgcggac cgaagaagcc aaacgctaca agaaccacag cgacctcaac       420
     ggacggctca tctgcgtctg ggaaggcacc acctccgcgg cggagctgaa gaagccggcg       480
     tacagcctga tccgtaccgt cgacatgaca gacgcccagg aatgcgtcaa ggcactgaag       540
     gaaaagagag tcgatgctct ctccaccgac caactgatcc tctacgggtt catgaaagat       600
     gatcccagca tcaccgtcgc gcacgccctg acgttcggcc ccttcaacga ctacggcatc       660
     gccatggcca agggccaccg cgaagactgc aagaagctcc agcaggccct catggactac       720
     gcacagagca acgactggga ccgggacttc cagatcaatc tgcccctcgt gcccaagaag       780
     gaccgcgacg aggccaggcc caccgacgac gagatcgaga ggagctcctg cctcgacaga       840
     ccgagcaacg cgaaggtgga cggctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page