(data stored in ACNUC7421 zone)

EMBL: AP009493.PE19

AP009493.PE19        Location/Qualifiers
FT   CDS_pept        26497..26952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_19t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_19t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16848"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM2"
FT                   /protein_id="BAG16848.1"
FT                   /translation="MQAIIDADGRLVIASARPVPGNEADAHTWRESDLPAIAAGTTVIA
FT                   DGAHLGTGLIVPHRRRARRPLLRGQEEDNAEHRCVRHPRRAHLRPHKELENPPRLPPER
FT                   RRPPPRRPSRRHTPQPRPWPHDPHDTRTRLHLPSTGHLQHALLIVSE"
     gtgcaggcca tcatcgatgc ggacggccgc ctggtgatcg cctcagcccg ccccgtcccc        60
     gggaacgagg ccgacgccca cacctggcga gaatcggacc tgcccgccat cgcggccggg       120
     accacggtca tcgcggacgg cgcacacctg ggaaccggac tgatcgtccc gcaccgcaga       180
     agagccagac gcccactcct gcgcggccag gaggaggaca acgccgaaca ccgatgcgtc       240
     cggcacccgc gtcgagcaca cctccgcccg cataaagaac tggaaaatcc tccgcggctg       300
     ccgccagaaa ggagacggcc tccaccacgc cgtccaagcc gtcgccacac tccacaacca       360
     cgcccctggc cgcatgatcc acacgacacc agaaccaggc tccacctgcc cagcaccgga       420
     catctgcaac acgctttact gatcgtttca gaatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page