(data stored in ACNUC7421 zone)

EMBL: AP009493.PE190

AP009493.PE190       Location/Qualifiers
FT   CDS_pept        complement(195740..196546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17019"
FT                   /db_xref="GOA:B1VNJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ6"
FT                   /protein_id="BAG17019.1"
FT                   /translation="MSSGGPGADRGSEAANVTSSGVGSSSFGSVGDNATFKWELKRTLT
FT                   HVAWLPVSACLVIAATVVFAVFAVAQWPGGPQNQYVWFYVLAALGLLAAGTAALYPVGR
FT                   TGQIRDAAQQVAETQRRTTIRAVLVGAAALCSGGGALAWVDVDRTGEIGVEMTIRGTQP
FT                   VDDTGGTLTVMMTPPPDGYVRDKLRLTLTIKDDDPNTPTCVGRTTATITSVTPGITPHS
FT                   TEVPAQSTVDFDLGGREGAVHFDVAVRPETGCSMRLAQARGTLHND"
     gtgagctccg gcggccccgg cgctgacaga ggctccgagg ccgccaacgt cacgtccagt        60
     ggcgtcggtt cgtcctcgtt cggctcggtc ggtgacaacg ccacgttcaa atgggagctc       120
     aagcggacgc tgacgcacgt cgcctggctc cccgtatccg cctgtctcgt catcgccgca       180
     accgtcgtct tcgccgtctt cgccgtcgcc cagtggcccg gcggtccaca gaaccagtac       240
     gtctggttct acgtcctcgc ggccctcggc ctgctggccg ccggcaccgc cgccctgtac       300
     ccggtcggcc gtaccgggca gattcgcgac gccgcacagc aggtcgccga gacacaacgg       360
     cgcacaacca tccgggccgt cctcgtcggt gccgccgcgc tctgcagcgg tggcggcgcg       420
     ctcgcctggg tggacgtcga ccgtacgggc gagatcggcg tcgagatgac catcaggggc       480
     acgcagcccg tggacgacac cggcggcaca ctcacggtga tgatgacacc gccgcccgac       540
     ggctacgtac gggacaagct gcgcttgacg ctgaccatca aggacgacga cccgaacacg       600
     cccacctgcg tcggcaggac cacggcgacg atcacctccg tcactccggg catcaccccg       660
     cacagtacgg aagtccccgc gcagtcgacc gtcgacttcg acctcggcgg gcgcgagggt       720
     gcggttcact tcgacgtcgc cgtcaggccg gagacaggct gttccatgcg tcttgcgcag       780
     gcccggggaa cgctgcacaa cgactga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page