(data stored in ACNUC7421 zone)

EMBL: AP009493.PE191

AP009493.PE191       Location/Qualifiers
FT   CDS_pept        complement(196543..197007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_191"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17020"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ7"
FT                   /protein_id="BAG17020.1"
FT                   /translation="MTGLPEISAELATYFSLTAEVLGAAMVASAAQRLTDGSIDAGQGY
FT                   FRRIFRRDSGEDTPIALPEGRSEQRADQLLGALSTEDRQRLAAALTAWLGEQRDRRPDE
FT                   ARLAELMAAAPTSHRTYHVTATGPNSAAIGSVGNGATFHFGGGSRHGDGA"
     atgaccggtc ttcctgaaat ctccgctgaa ctcgccacct acttctccct gacggccgag        60
     gtcttgggcg ccgctatggt ggcgagtgct gcacagcggc tcacggacgg ttcgatcgac       120
     gcaggccagg gctactttcg caggatcttc cgtcgcgaca gcggcgagga caccccgatc       180
     gctctgcccg agggccgcag cgaacagcgc gccgaccaac tgctcggcgc gctttccacc       240
     gaggacaggc agcggctggc ggcagccctg acggcgtggc tcggcgaaca gcgggaccga       300
     cgtccggacg aggcccgtct ggcggaactg atggcagccg ccccgacctc ccaccgtacg       360
     taccacgtca cggcaaccgg cccgaattcc gccgctatcg ggtcggtggg gaacggtgcc       420
     accttccact tcggcggcgg cagtcgtcac ggggacggag cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page