(data stored in ACNUC7421 zone)

EMBL: AP009493.PE193

AP009493.PE193       Location/Qualifiers
FT   CDS_pept        198260..198874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_193"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17022"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNJ9"
FT                   /protein_id="BAG17022.1"
FT                   /translation="MPSQSHSYADRGSPSCARPGGTVNRPLLFLDVDGPLNPYAAKPER
FT                   RPDGYTTLRVPRNDEHQDDRRLTSRRPLRVWLNPEHGRFLLQLGFELCWATTWMDDANR
FT                   WIAPVLGLPELPFVDFGDVLLRERPDGVHWKTGPLVDYAGGRPFAWVDDEQSELDQTFV
FT                   AAHHQGAGLLHHVNPRIGLRKNDFHLLADFARSLDTSRTTG"
     atgccgagtc aatcccacag ttacgctgat cggggcagtc catcgtgcgc aagacccggg        60
     ggaaccgtga accgaccact gctgttcctt gacgttgacg ggccgctcaa cccttacgcg       120
     gccaagccgg agagacgtcc cgacggctac accacactca gagtcccccg gaacgacgag       180
     catcaggacg acagaaggct cacgtctcga cggcccctgc gggtctggct caacccggag       240
     catggacgat tcctgctcca gctcggcttc gagctgtgct gggccaccac atggatggac       300
     gacgccaacc ggtggatcgc accggtcctg ggcctaccag aacttccctt tgtggacttc       360
     ggcgacgtcc tactccggga acgccctgat ggagtccact ggaagaccgg gccgctggtg       420
     gactacgcag gcggccgtcc tttcgcgtgg gtggacgacg agcagagtga gctggatcag       480
     accttcgtgg ccgctcacca ccaaggcgcc gggctcctgc accacgtcaa cccgcggatc       540
     ggcctacgga agaacgactt ccacttgctc gccgacttcg cccggtccct ggacacctcg       600
     cgaaccaccg gttga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page