(data stored in ACNUC7421 zone)

EMBL: AP009493.PE195

AP009493.PE195       Location/Qualifiers
FT   CDS_pept        complement(199266..199601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_195"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17024"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK1"
FT                   /protein_id="BAG17024.1"
FT                   /translation="MIIHSPRSTCDTRPKLAVQPRCEMSRASDSVGQQNHARRGLVTTN
FT                   QWTLSRPCCLSRIGGAPSRWTWRRYRRRTGAPAISSTGEATRSATGTRALAAASFAFSS
FT                   YRMRSVC"
     gtgatcatcc acagcccaag atccacttgc gacacacggc ccaagcttgc cgttcaacct        60
     cgatgcgaga tgagtcgggc gagcgactct gtgggccagc agaaccacgc gagaagaggg       120
     ctggtgacca cgaaccagtg gacactgagt cggccctgct gcttgtccag gatcggtggg       180
     gccccatccc ggtggacgtg gcggagatat cggcgacgga ccggcgctcc ggcgatcagc       240
     agcactggtg aggcgacgag gagcgccacc gggaccaggg ctctcgcggc ggcgagtttc       300
     gccttctcct cgtatcgcat gcgctcagtg tgctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page