(data stored in ACNUC7421 zone)

EMBL: AP009493.PE197

AP009493.PE197       Location/Qualifiers
FT   CDS_pept        complement(200565..201203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_197"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17026"
FT                   /db_xref="GOA:B1VNK3"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK3"
FT                   /protein_id="BAG17026.1"
FT                   /translation="MRDVRVVLIGGTSNVGKSTVAQAVAERLGFACLSTDALARHPGRP
FT                   WRTSEGEVPAHVAEHYGSLTVNDLITSVLDHYDRLWPRIEELITTRAVEDRGSAGLVLE
FT                   GSALWPVRVARLQVPHTAAVWLSTDDSVVRSRVHAAGSYETATAAERILMDKFLARTER
FT                   YQALMIEAVGRLGLDRIDAGDGQSAGELADMVLAAVDAQTAPGRASNDR"
     gtgcgtgatg tgcgagtggt tctgatcggc ggtacgtcga atgtcggcaa gtcgaccgtg        60
     gcccaagcgg ttgcggaaag gctcgggttc gcgtgcctga gtaccgacgc gctggcccgg       120
     caccctgggc gaccctggag aacctcggag ggggaggtgc cggcgcacgt cgctgagcac       180
     tacgggtccc ttacggtgaa cgatctgatc acgtctgtgt tggaccacta cgatcggctc       240
     tggccgcgca tcgaagaact gatcaccacg cgtgcggtcg aagaccgcgg cagtgcgggc       300
     ctggtgcttg aggggtcggc actctggccc gtgcgcgtag cgcggctcca ggtcccgcac       360
     acggccgccg tgtggctctc caccgacgac tccgtggtac gttcccgcgt tcacgccgcg       420
     ggcagctacg aaacggctac agctgcggaa cggatcctga tggacaagtt cctggcccgc       480
     acggagcgct accaggcact gatgatcgag gccgtcggcc ggctgggcct ggatcgcatc       540
     gacgcgggtg atggacagtc cgccggggaa ctggctgaca tggtgctcgc ggcagtcgac       600
     gcgcagaccg cgccgggacg ggcatccaac gatcggtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page