(data stored in ACNUC7421 zone)

EMBL: AP009493.PE198

AP009493.PE198       Location/Qualifiers
FT   CDS_pept        201820..202455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_198"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17027"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK4"
FT                   /protein_id="BAG17027.1"
FT                   /translation="MVYQNDAIKGECVNTEKLTARRLTAEETAELGPQDSVFVPASMDG
FT                   VSPDCYAPAFLTKPGKSFEGGSFIARTAFGEEVHVLPDNAEEGGIWIADKAGEAIEVLQ
FT                   SAGVLLNLALFVPGGNKESLESLYSAAREAFGAGVVQRWSEEVVEVPDVKVDLYEEPAR
FT                   GRKNANNQNRDRRALDIFPTRVRFLEPSEGWKFVVEPHKEIVDETPTI"
     atggtttatc agaacgacgc gataaaaggg gaatgcgtga ataccgagaa gcttacggct        60
     cgacgtctca cggctgaaga gactgcagaa ttgggccccc aggacagcgt cttcgtcccg       120
     gcaagcatgg acggcgtatc ccccgactgc tacgcacctg ccttcctcac gaagccgggg       180
     aagagtttcg aaggtggctc cttcattgca cggacggcgt tcggcgagga ggtgcacgtc       240
     cttcccgaca acgccgaaga aggcgggatc tggattgcgg acaaggcagg ggaggcaatc       300
     gaggtcctcc agagcgccgg cgttctcctg aacctggccc tcttcgttcc cggcggaaac       360
     aaggagtccc tggaatctct ctattccgcg gcccgggaag cattcggcgc gggggtcgtc       420
     cagcgctgga gcgaggaagt cgtcgaagtg ccggacgtca aggtcgacct gtacgaggag       480
     ccggcccggg gacgcaagaa cgcgaacaac cagaatcgcg accgccgcgc cctggacatc       540
     tttccgacgc gcgtacggtt ccttgagccg agcgagggct ggaagttcgt cgtcgaaccg       600
     cacaaggaga tcgtcgacga gacgccgacc atctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page