(data stored in ACNUC7421 zone)

EMBL: AP009493.PE199

AP009493.PE199       Location/Qualifiers
FT   CDS_pept        203293..204375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_199"
FT                   /product="putative secreted cellulose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_199"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17028"
FT                   /db_xref="GOA:B1VNK5"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK5"
FT                   /protein_id="BAG17028.1"
FT                   /translation="MARRKKLLTSLVAVLATLLGGIGLTLMGQDNAQAHGVTMTPGSRT
FT                   YLCMLDARTGTGALDPTNPACKAALDESGANALYNWFAVLDSNAGGRGAGYVPDGTLCS
FT                   AGDRSPYDFTGYNAPRSDWPRTHLTAGKTIQVKHSNWAAHPGSFRVYLSKPGYSPSTEL
FT                   GWDDLELIETVTDPPQSGGPGTDGGHYYWNLDLPSGRSGDAVMFIQWVRSDSQENFFSC
FT                   SDIVFDGGNGEVTGIRGSGGTPNPTPTPTPTPTDPHSGCMAVYSVANSWSGGFQGSVEV
FT                   MNHGTTAREGWAVRWKPGVGVTVGNTWNGALTTGPDGTVTVRNLAHNRTIAPEGSVTFG
FT                   FTATSTGNDFPVGSIGCVTP"
     atggcccgac gcaagaagct tctcacctcg ctggtggcgg tgctcgcgac gctgctcggc        60
     ggaatcggcc tgaccttgat gggtcaggac aacgctcagg cgcacggcgt cacgatgacg       120
     ccgggatcgc gcacctacct ctgcatgctg gacgccagga ccggcaccgg cgctctggac       180
     ccgacgaacc cggcctgcaa ggccgcgctc gacgagagcg gtgcgaacgc gctgtacaac       240
     tggttcgccg tactcgactc caacgccggc ggacgggggg ctggttacgt gccggacgga       300
     acgctgtgca gcgccggtga ccggtcgccg tacgacttca cgggctacaa cgccccgcgc       360
     tccgactggc cccggacgca tctgacggcc gggaagacca tccaggtcaa gcacagcaac       420
     tgggcagcgc acccgggctc cttccgggtg tacctgtcca agcccggcta ctcgcccagc       480
     accgagctgg gctgggacga tctggagctg atcgagaccg tcaccgaccc gccgcagtcc       540
     ggcggtccgg gcaccgacgg cggccactac tactggaacc tggaccttcc ctccggccgc       600
     tcgggggacg ccgtcatgtt catccagtgg gtgcgttcgg acagccagga gaacttcttc       660
     tcctgctccg acatcgtctt cgacggcggc aacggtgagg tgaccggcat ccggggctcg       720
     ggcggcacgc cgaacccaac gcccacgccg acccccaccc ccaccgaccc gcactccggg       780
     tgcatggccg tctacagcgt ggccaactcc tggagcggcg gcttccaggg ctccgtcgag       840
     gtcatgaacc acggcacgac ggcgcgcgag ggctgggccg tgcggtggaa gcccggcgtc       900
     ggcgtcaccg tcggcaacac gtggaacggt gctctgacca cggggcccga cggcactgtc       960
     acggtcagga acctcgccca caaccgcacc atcgcaccgg agggcagcgt caccttcggg      1020
     ttcaccgcca catcgaccgg aaacgacttc ccggtcggct cgatcggctg cgtaaccccg      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page