(data stored in ACNUC7421 zone)

EMBL: AP009493.PE2

AP009493.PE2         Location/Qualifiers
FT   CDS_pept        3401..3919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_2t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_2t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16831"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK0"
FT                   /protein_id="BAG16831.1"
FT                   /translation="MTWQGGSAGSGAGTISSRAAPGVSTGLLQAPAICLPDFLLRRLLI
FT                   STVATMTLDDPTAKVREVMLVERPIGTRLSRSRTPGGNSALARDDDNSLVTHAVLYPTE
FT                   AFTAEEVVKIVGATAALAATAGIAVGAVAMKAGPRVKSTFSGLRSKLTLKAEEVTAAAA
FT                   EQVPEQPGT"
     gtgacctggc agggcgggtc ggcgggatcg ggcgctggca ccatctcctc acgtgcagcg        60
     cccggcgtgt cgacgggtct gctgcaggcc ccggctatct gtttgccgga cttcctgctg       120
     cgacggttac tgatctctac agttgccacc atgacccttg atgacccgac cgcgaaggtt       180
     cgggaagtga tgctcgtcga gcggcccatc gggacccgcc tctcccggtc tcgtactccc       240
     gggggtaaca gtgctctcgc gcgagatgat gacaactcgc tcgtcacgca cgcggtgctc       300
     tacccgaccg aggccttcac ggctgaagaa gtggtcaaga tcgtcggagc taccgcggct       360
     ctcgcggcca cggcgggcat cgcggtgggc gcagtcgcta tgaaggccgg accgcgcgtg       420
     aagagcacgt tcagtggcct caggtcgaag ctgaccctca aggccgagga agtcacagcg       480
     gctgccgctg agcaggtgcc ggagcagccc ggcacataa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page