(data stored in ACNUC7421 zone)

EMBL: AP009493.PE20

AP009493.PE20        Location/Qualifiers
FT   CDS_pept        26949..27332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_20t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_20t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16849"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM3"
FT                   /protein_id="BAG16849.1"
FT                   /translation="MKRLARELCAAMMRIRLGGGGRGHQMTRWQLLQGDVLVGELSEYG
FT                   CDQPFFLARFTPGPGWESVRPSFEALATYRGPDPDGLRFVALAKPLQDLGLTLAPVDGQ
FT                   QTPLQLFKDCMVRIYGAEARLRY"
     atgaagcgct tggccagaga gttatgcgct gcgatgatgc gaattcgact gggtggtggg        60
     ggacggggac accagatgac gcggtggcag ctcttgcagg gagacgtcct ggtcggtgag       120
     ctcagtgagt acggctgtga tcagccgttc ttcctggcgc gcttcacccc gggacctggc       180
     tgggagagcg tgaggccgtc gtttgaggca ttggcgacct acaggggccc ggacccggat       240
     gggctcaggt tcgtcgccct ggccaagccg ttgcaggatt tggggctcac actggctccg       300
     gttgacggtc agcagactcc gttgcagctc ttcaaggact gcatggtgcg tatctatggg       360
     gctgaagctc gcctccgcta ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page