(data stored in ACNUC7421 zone)

EMBL: AP009493.PE201

AP009493.PE201       Location/Qualifiers
FT   CDS_pept        205971..207002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_201"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17030"
FT                   /db_xref="GOA:B1VNK7"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK7"
FT                   /protein_id="BAG17030.1"
FT                   /translation="MTHTAAEAPRDERRRRAGGRGRRWGLSACGVALIAPAVLLVVRLT
FT                   GLDAGTPLAMPMVLFPWTTVIGVLVLLLLAAVPVLRSRWALVGTAALVTAHAVLLAPRF
FT                   LSDGPQVAEGAVELRVATINTNGGAADARAVVRLVRTERIDVLAVQQMPPGGVEALDRA
FT                   GLGALLPHQELHPEYDSSVYSRLPLGEAGTTRADTAWPQTVAEVAVGGRSVRFVAVHTY
FT                   YPLGSPERWTRDMAALTSLARRAGPDTVFLGDFNASLDHAPMRDLLAAGLTDTHAELGR
FT                   GWAPTWPVGLMLVPPVVQLDHVLHGSGLAGVSVGERTVPGTDHRAVVAVLALLPERAGE
FT                   RSR"
     gtgacgcaca cggctgcaga agccccgcgc gatgagagac ggcggcgggc cggtggtcgc        60
     ggacggcgct gggggctgtc ggcctgcggg gtcgcgctca tcgcgcccgc cgtcctgctc       120
     gtcgtccggc tgacagggct cgacgccgga acaccgctgg cgatgccgat ggtcctgttc       180
     ccgtggacga ccgtcatcgg tgtgctggtg ctgctgctgt tggccgctgt tcccgtactg       240
     cggtcccggt gggcgctggt cggcaccgcg gccctggtga ccgctcacgc ggtcctgctg       300
     gccccccggt tcctgtccga cggcccgcag gtggcggaag gcgcggtgga gctgcgcgtg       360
     gccaccatca acaccaacgg aggcgccgcc gacgcccggg cggtggtgcg gctggtccgg       420
     acggagcgga tcgatgttct ggcggtgcag cagatgccgc cgggcggggt ggaggccctc       480
     gacagggcgg gcctgggcgc cttgctgccg caccaggaac tccacccgga gtacgactcc       540
     tccgtctact cgcggctccc gctcggcgaa gccggtacga ctcgggccga cacggcctgg       600
     ccccagaccg tcgccgaggt cgcggtcggc ggccgtagcg tgcggttcgt ggcggtgcac       660
     acgtactacc ccctcgggag cccggagcgg tggacccggg acatggccgc gctcacctcg       720
     ctggcacggc gcgcggggcc ggacaccgtg ttcctgggtg acttcaacgc ctcgctcgac       780
     cacgccccga tgcgggacct gctcgcggcc ggcctcacgg acacccatgc cgagctcggt       840
     cgtgggtggg ctcccacgtg gcccgtcggc ctcatgctcg tcccacccgt ggtccagttg       900
     gatcacgtcc tgcacggttc cggtctggcg ggggtctcgg tgggcgagcg gactgtgccg       960
     ggaaccgatc atcgagccgt cgtcgcggtg ctcgcgcttc tgccggagag ggccggggag      1020
     cggagccggt ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page