(data stored in ACNUC7421 zone)

EMBL: AP009493.PE202

AP009493.PE202       Location/Qualifiers
FT   CDS_pept        complement(207370..208281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_202"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_202"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17031"
FT                   /db_xref="GOA:B1VNK8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNK8"
FT                   /protein_id="BAG17031.1"
FT                   /translation="MQTDTSPTSAPLPTGADGPPPARGAGRGAGVALMLGSGLSNQTGA
FT                   SVAALAFPVIGPTGVVAVRQWVAAVVLGAVARPRLRHFTAAQWRPVLGLALVFAGMNLS
FT                   LYTAIDRIGLGLAVTLEFLGPLTVALAGSRRPLDLAAAGAAAGAVAVLMRPTPSTDYPG
FT                   IGLALLAAACWACYILLNRTVGARLPGLEGSAAAAIVSAVLYLPVGVWVLRHHPPTPTA
FT                   LGCALAAGVLSSAVPFLADLMALRRVPAHFFGVFMSVNPVFAALVGLAVLGQRLDALAW
FT                   LAIAVIVAANTTAVATSRRRTP"
     atgcagaccg acacatctcc gacctcagca cccctcccga ccggagccga cggcccgccg        60
     ccagcgaggg gggcggggcg cggagccggt gtggccctga tgctgggcag cggcctctcc       120
     aaccagacgg gcgcctccgt cgcggcgctg gcctttccgg tgatcggacc cacaggagtc       180
     gtggcggtac gccagtgggt ggccgccgtc gtcctcggcg cggtcgcgag gccacggctg       240
     cgacacttca ccgccgcgca gtggcgcccc gtcctgggcc tcgccctggt gttcgccggg       300
     atgaacctct ccctgtacac ggcgatcgac aggatcggcc tcgggctggc cgtcacgctg       360
     gagttcctag gcccgctgac cgtcgccctg gccggctccc gccgccccct cgacctggcc       420
     gccgccgggg cagccgcggg cgcggtggcg gttctcatgc gccccacacc ctccaccgac       480
     tatccgggca tcggcctggc cctcctggcg gcggcctgct gggcctgtta catcctgctc       540
     aaccggaccg tcggagcccg cctgcccggc ctggagggct cggccgcagc ggcgatcgtc       600
     tccgccgtgc tctacctgcc cgtcggcgtc tgggtgctcc ggcaccaccc gcccacgccc       660
     accgcgctgg gctgcgccct cgccgccggg gtgctctcct cggcggtgcc gttcctcgcc       720
     gacctcatgg cgctgcgccg tgtcccggcg cacttcttcg gagtgttcat gagcgtcaac       780
     ccggtcttcg ccgccctcgt cggcctcgcc gttctcgggc agcggctcga cgccctcgcc       840
     tggctggcca tcgcggtgat cgtcgccgcg aacaccactg ccgtcgccac ctcccgccgc       900
     agaaccccct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page