(data stored in ACNUC7421 zone)

EMBL: AP009493.PE205

AP009493.PE205       Location/Qualifiers
FT   CDS_pept        complement(209967..211151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_205"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_205"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17034"
FT                   /db_xref="GOA:B1VNL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL1"
FT                   /protein_id="BAG17034.1"
FT                   /translation="MNQRPLPETASTVPSPHRWNAVLWVLLGVVPPAIAVADAPGTTRL
FT                   PVLGLLAVLALSYAAVGLFPGNPVLSPRPYLYVQVVGLGALSYLLDGGAALFVVTLPHF
FT                   WIYTASARAAIALSGLAAAAVVTGNVVRQGWDGEFFTGNVIFTLIGYAAGVLIGSGVRH
FT                   ITEDADERARRLRAELEEARLRLVEAHHRQGAADERERLAREIHDTLAQGFASIVVLAE
FT                   AARSGLATDPGTSGKHLLAIENTARENLAEARVLVGSAPQGGAATGSVADTLRRTLRRF
FT                   TEDTGTPVTSELPDVTCDQRTRIALLRCTQESLANIRKHAAASTVDVVLTAQPYGIELE
FT                   ITDDGTGFVTADSRGFGLHGMRGRLAELGGELTVTSSVGDGTRVLAMIPTDGQG"
     gtgaatcaac ggcccctgcc cgaaaccgcg tcgaccgtac cgtcgccgca ccggtggaac        60
     gccgtcctct gggtgctcct gggcgtggtc ccgccggcca tcgccgtcgc cgacgcaccc       120
     gggacgacgc gcctgccggt gctggggctg ctggccgtcc tcgccctgtc gtacgccgcg       180
     gtggggctgt tccccggcaa ccccgtcctg agcccccgcc cctacctgta cgtgcaggtc       240
     gtgggcctcg gggccctgtc gtacctgctc gacggcggcg cggccctctt cgtggtgacc       300
     ctgccgcact tctggatcta caccgcgagc gcgcgtgccg cgatcgccct gagcggtctc       360
     gccgccgcgg ccgtcgtcac cggcaacgtg gtgcgacagg gctgggacgg ggagttcttc       420
     accggcaacg tgatcttcac gctcatcggg tacgcggcag gcgtgctcat cggctcgggg       480
     gtgcgccaca tcacggagga cgccgacgag cgggcccgcc ggctgcgcgc cgaactggag       540
     gaagcgcggc tccggctcgt cgaggcacac caccgccagg gcgcggcgga cgagcgcgaa       600
     cggctcgcgc gcgagatcca cgacaccctc gcccagggct tcgcgtccat cgtcgtgctc       660
     gccgaggccg ccagatccgg tctggccacc gacccgggca cgagcgggaa acacctgctc       720
     gcgatcgaga acaccgcgcg cgagaacctc gccgaggccc gcgtcctcgt cggctcggcc       780
     ccgcagggcg gcgccgccac cggctcggtg gccgacaccc tgcgacggac cctgcggcgg       840
     ttcaccgagg acaccggaac ccccgtcacc tccgaactgc cggacgtcac ctgcgaccag       900
     cggacccgga tcgctctcct gcgctgcacc caggagtccc tcgccaacat ccgcaagcac       960
     gcggcggcct ccaccgtgga cgtggtcctc accgctcagc cgtacgggat cgaactggag      1020
     atcaccgacg acggcacggg cttcgtgacg gcggactccc gcggcttcgg gctgcacggc      1080
     atgcgcggac gcctggccga gctcggcggc gagctcaccg tcaccagctc ggtcggcgac      1140
     ggcacccgcg tcctggccat gattcccacc gacggacagg gctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page