(data stored in ACNUC7421 zone)

EMBL: AP009493.PE206

AP009493.PE206       Location/Qualifiers
FT   CDS_pept        complement(211148..213418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_206"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_206"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17035"
FT                   /db_xref="GOA:B1VNL2"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL2"
FT                   /protein_id="BAG17035.1"
FT                   /translation="MRHLPVRMARWSARHAGRAIAGWFTFVVLCLAAGLALGTNEATTR
FT                   DFWVGEAGRAEATATEGGLERSPTERIMIRAGAGELDMAAAGAAARDVTRRMRDLPEVE
FT                   SVAAPVRSKDGKVLLVSVVLNGPELEGKKNVVPLLEQTAAVAADHPDLVVEETGSPAIS
FT                   KGVNDQRDEDLALSERVSLPVTAITLLVVFGSVIMAGVPLLLALSSIAAAIGLSMAASH
FT                   LMPDAGVGTNLILLIGLAVGVDYTLFYLKREREEQARAGGRLGPEARVELAAATAGRAI
FT                   VVSGLAVIVSTATLYLATDVIFSSLATGTVLVVAVAVASSLTVLPALLVVIGRRADRLA
FT                   PRRAARRARSGRPPRAEKPETGRVFGALLRPARTRPALTLCLSVLVMLGLAVPALGLKL
FT                   IDPGRDTFSRDIPAMRVYDRLTESFPELLVTHEVVTRSTPERAAQVRRALEDLGRRAQA
FT                   DPLFAQPPRNGYEANDSEGATSPTDPAAPGPTVRTSADGRVSVLELPVPHPAPSAEAIA
FT                   SLTHLRQDHIPATVGRLPGVETAVSGDVARGRDYVSHESDRLPLVLGSLLLMTFLMTVW
FT                   AFRSVVIGAIGVVLNLLSAGASLGMLVLVFQGTWAEGLLAFDSLGAIASRVPLFLVVIL
FT                   FGLSMDYQVFVVSRIQEARQNGMSARDAVLEGINRSAKVVTSAAIVMVTVFGAFVALHL
FT                   TEMKQMGFCLAVAVLLDAVVIRLLVLPSVLLLLGERAWWPARRPGRSPEPAAGPRTESR
FT                   LTR"
     atgagacacc tacctgtacg gatggcccga tggagcgccc ggcacgccgg gcgggcgatc        60
     gccggctggt tcacgttcgt cgtcctgtgc cttgcggccg gcctcgcgct gggcaccaac       120
     gaggccacca ccagagactt ctgggtcggc gaggcgggac gcgccgaggc gacggcgacc       180
     gagggaggcc tggagaggtc ccccaccgag cggatcatga tccgggccgg ggcgggggag       240
     ctggacatgg ccgcggccgg tgcggcggcc cgggacgtga cccggcggat gcgggacctg       300
     cccgaggtgg agagcgtggc cgctcccgtc cgctcgaagg acgggaaggt cctgctggtc       360
     tcggtggtcc tgaacggacc cgagctggag gggaagaaga acgtcgtacc gctgctggag       420
     cagacggcgg ccgtggccgc cgaccacccg gacctggtgg tggaggagac cggatccccc       480
     gccatcagca agggcgtcaa cgaccagcgc gacgaggatc tcgccctctc cgaacgcgtc       540
     agcctgcccg tcaccgccat caccctgctg gtcgtgttcg gctcggtgat catggcgggt       600
     gtgcccctgc tgctggcgct ctcctcgatc gccgcggcga tcggactctc catggccgcc       660
     tcgcacctca tgcccgacgc gggggtcggg acgaacctca tcctgctcat cggcctggcg       720
     gtcggcgtcg actacaccct cttctacctg aagcgcgaac gggaggaaca agcgcgcgcg       780
     ggcgggcggc tgggcccgga ggcgcgcgtc gagctagctg cggcgacggc cggccgggcc       840
     atcgtggtct ctggcctcgc cgtcatcgtc tccaccgcca ccctctacct ggccacggac       900
     gtcatcttct cctcactggc gaccggcacc gtcctcgtgg tggccgtcgc ggtggccagc       960
     tccctcaccg tgctccccgc actcctggtc gtcatcggcc gccgcgccga ccgcctcgcg      1020
     ccccgcaggg ccgcccgccg ggcccggagc ggcagaccgc cccgcgccga gaagccggag      1080
     acgggacggg tgttcggcgc tctgctgcgt cccgcccgga cccgccccgc cctcaccctg      1140
     tgcctgtccg tcctcgtcat gctcggcctg gccgtgcccg cactcggcct gaagctgatc      1200
     gaccccggaa gggacacctt ctcccgcgac atcccggcca tgcgggtcta cgaccggctg      1260
     accgagagct tccccgaact cctcgtcacc catgaggtcg tcacccgctc cacgccggaa      1320
     cgggcggcac aggtgaggcg ggccctggag gacctcggcc gccgggcgca ggcggacccc      1380
     ctgttcgccc agccgccgag gaacggatac gaggcgaacg actccgaggg ggccacgagc      1440
     cccacggacc cggcggcgcc cgggccgacg gtccgtacgt ccgccgacgg ccgcgtcagc      1500
     gtgctggaac tccccgtgcc ccatcccgcg ccctccgccg aggcgatcgc gtcgctcacc      1560
     cacctccgcc aggaccacat ccccgcgacc gtcggccgac tgcccggcgt ggagacggcg      1620
     gtgagcggcg acgtcgcgcg gggccgcgac tacgtgagcc acgagagcga cagactgccg      1680
     ctggtcctcg gctccctcct gctgatgacc ttcctgatga ccgtgtgggc cttccgctcc      1740
     gtggtgatcg gcgcgatcgg cgtcgtactg aacctgctct ccgccggcgc ctcgctcggc      1800
     atgctggttc tggtcttcca agggacgtgg gcggaggggc tgctggcctt cgactccctc      1860
     ggggcgatcg cgtccagggt tccgctgttc ctcgtggtga tcctcttcgg cctgtcgatg      1920
     gactaccagg tcttcgtggt cagccggatc caggaggccc gacagaacgg catgtccgcc      1980
     cgtgacgcgg tcctggaggg catcaaccgt tcggccaagg tggtgaccag cgcggccatc      2040
     gtcatggtga cggtgttcgg cgcgttcgtg gccctgcacc tcaccgagat gaagcagatg      2100
     ggattctgcc tggccgtggc cgtcctgctg gacgccgtgg tcatccggct cctggtcctg      2160
     ccgtcggtgc tgctgctcct cggtgagcgc gcctggtggc cggcccgccg ccccggccgg      2220
     agtccggagc ccgccgccgg accccggacg gaaagtaggc tgacgcggtg a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page