(data stored in ACNUC7421 zone)

EMBL: AP009493.PE210

AP009493.PE210       Location/Qualifiers
FT   CDS_pept        217276..218208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_210"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17039"
FT                   /db_xref="GOA:B1VNL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL6"
FT                   /protein_id="BAG17039.1"
FT                   /translation="MAPTAAVATPPPEKSRRRRARPRRLPYLLIAPAGLLMLGFIAYPV
FT                   LSVFSYSLQHYNVTKPWRNGFAGLDNFRRVFTEDDQFWPTLAFSAQWVFTQVTLQLLLG
FT                   LALALIVNQTFIGRGISRAMVFSPWAVSGVLTSTIWILLYNSSTGFSRYLADAGIGEYG
FT                   TSVLSDTGTVFWAATVTELWRGVPFFAILILADLQSVSKELYEAASVDGAGRLRQFFHI
FT                   TLPHLRDAIILATLLRGVWEFNNVDLLYTLTGGGPAGETTTLPLYVANTGIEGHDFGYA
FT                   SALTTVAFVILLFCSIVYLRLSKFGGDRT"
     atggccccaa ccgcagccgt ggccacaccg ccgcccgaaa agtcccggcg ccgccgggcg        60
     agaccccgcc gcctgccgta tctgctgatc gcgcccgcgg gcctgttgat gctgggcttc       120
     atcgcctatc cggtgctcag cgtcttctcc tacagcctgc agcactacaa cgtcaccaag       180
     ccgtggcgga atggcttcgc cgggctcgac aacttccgac gcgtcttcac cgaggacgac       240
     cagttctggc cgacgctcgc gttcagcgcc cagtgggtct tcacccaggt caccctgcaa       300
     ctcctcctcg gtctggcgct cgccctgatc gtcaaccaga cgttcatcgg gcgcggcatc       360
     tcccgggcca tggtcttctc accgtgggcc gtctccggag tgctgaccag cacgatctgg       420
     atcctgctct acaactcctc gacgggcttc agccgctatc tcgcggacgc cggaatcggc       480
     gagtacggca cgtcggtgct ctcggacacc gggaccgtgt tctgggcggc caccgtcacc       540
     gaactctggc gcggcgtccc gttcttcgcg attctcatcc tcgccgacct ccagtccgtc       600
     tcgaaggagt tgtacgaggc ggcttcggtc gacggcgcgg gccggctgcg gcagttcttc       660
     cacatcacgc tcccccacct gcgggacgcg atcatcctcg ccaccctgct gcgcggcgtc       720
     tgggagttca acaacgtcga cctgctctac accctcaccg ggggcgggcc cgcgggtgag       780
     accaccaccc tgcccctcta cgtggccaac accggcatcg agggccacga cttcgggtac       840
     gcctccgcgc tcaccaccgt cgccttcgtg atcctcctct tctgctcgat cgtctatctg       900
     cgcctgagca agttcggagg cgaccgcaca tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page