(data stored in ACNUC7421 zone)

EMBL: AP009493.PE211

AP009493.PE211       Location/Qualifiers
FT   CDS_pept        218205..219116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_211"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_211"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17040"
FT                   /db_xref="GOA:B1VNL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL7"
FT                   /protein_id="BAG17040.1"
FT                   /translation="MTALLTERNGTAPRSTAPGSPPSARRRRPGRERAFDDVPRWQIYL
FT                   PLGLYLLFTLVPFYWMLLFAVRPAGSTSLAPWPMTGAHFSKVWNERSFAVFFQNSMIVG
FT                   VATLVATTLVALAGGYALARFDFRIKGAFMLALLCSQFIPGALMLVPLFEIFRNLQMIN
FT                   SLGSVVIAETVFQLPLSIILISGFIKNVPVSLEEAAWVDGCSRFTAFRTVVLPLLRPGL
FT                   IAVGSFAFVHSWNHFLFALMFLSEQDKQTIPVGLNTLIGADSVDLGALAAGGVIAAVPV
FT                   VVVFAFIQKWLITGFSAGAVKG"
     atgaccgccc tgctcaccga gaggaacggg accgccccga ggtccaccgc tcccggctct        60
     ccaccgtcgg cccggcgccg ccggccggga cgggagcgcg ccttcgacga cgtaccgcgc       120
     tggcagatct atctgccgct cggcctctac ctgctgttca cgctcgtccc cttctactgg       180
     atgctgctct tcgccgtacg gcccgccggt tccacatcgc tggctccctg gccgatgacc       240
     ggagcgcact tctccaaggt ctggaacgag cggagcttcg cggtcttctt ccagaacagc       300
     atgatcgtcg gcgtcgcgac gctcgtcgcc acgaccctgg tcgccctggc cggcggctac       360
     gccctggccc ggttcgactt caggatcaag ggcgcgttca tgctggcgct gctctgctcg       420
     cagttcatcc cgggcgccct gatgctcgta ccgctgttcg agatcttccg gaacctccag       480
     atgatcaact cgctggggag cgtcgtcatc gcggagacgg tgttccagct tccgctgtcg       540
     atcatcctga tcagcggctt catcaagaac gtgcccgtct ccctggagga ggccgcctgg       600
     gtcgacggct gctcgcgctt caccgccttc cgcaccgtcg tcctgccgct cctgcgcccc       660
     gggctgatcg ccgtcggctc cttcgccttc gtgcacagct ggaaccactt cctcttcgcc       720
     ctgatgttcc tgagcgagca ggacaagcag acgatcccgg tcggcctcaa cacgctgatc       780
     ggcgcggaca gcgtcgacct gggcgcgctc gcggcgggcg gtgtcatcgc ggccgtcccc       840
     gtggtcgtcg tcttcgcctt catccagaag tggctcatca cgggcttcag cgccggggcg       900
     gtgaagggat ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page