(data stored in ACNUC7421 zone)

EMBL: AP009493.PE213

AP009493.PE213       Location/Qualifiers
FT   CDS_pept        220330..221184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_213"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17042"
FT                   /db_xref="InterPro:IPR029475"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNL9"
FT                   /protein_id="BAG17042.1"
FT                   /translation="MNQRPGAPFPDLPATLACDGRTVAHYGYAPGADGRPRLHPVTTLG
FT                   GTAVTEDRPADHLHHLGVSVAVPDVAGYNFWGGHTFVRGKGPTALDNHGVQRHLARPQR
FT                   SPNGFTQELGWEAAGVELLREHRTLSATRTSDASWELDFSFVLTNTGGEELSLGSPATN
FT                   GRPGAGYGGFFWRAPKEAAPPTVFSATGEGESEVHGRTADWLALSGAGWTLVFVGATAR
FT                   TRRDPWFVRTSAYPGVGSSLAAHERLPVPAGSSVVRRIITVVVDGRPDRETAARYAREA
FT                   VAR"
     atgaaccagc gccccggggc cccgttcccc gacctcccgg ccacccttgc ctgcgacggc        60
     cggaccgtcg cccactacgg ctacgcgccg ggggccgacg gccgcccccg cctccacccc       120
     gtcaccaccc tcggcgggac cgccgtcacc gaggaccgcc ccgccgacca cctccaccac       180
     ctgggcgtct ccgtcgccgt tcccgacgtc gccgggtaca acttctgggg cgggcacacc       240
     ttcgtacggg gcaaggggcc caccgcgctc gacaaccacg gcgtccagcg ccacctggcc       300
     cggccgcagc gcagcccgaa cggcttcacc caggagctcg gctgggaggc ggccggcgtc       360
     gagctcctgc gcgagcaccg caccctgtcg gccaccagga cctcggacgc ctcctgggag       420
     ctggacttct ccttcgtgct caccaacacc gggggcgagg agctctccct cggcagcccc       480
     gcgacgaacg gccggcccgg cgccgggtac ggcggcttct tctggcgcgc ccccaaggag       540
     gcagcgccac cgaccgtgtt cagcgccacg ggcgagggcg agagcgaggt ccacggccgc       600
     accgccgact ggctggccct ctccggggcc gggtggacgc tcgtgttcgt gggggccacg       660
     gcacggaccc ggcgcgaccc gtggttcgta cggacctccg cgtacccggg cgtcggctcc       720
     agcctggcgg cgcacgagcg gctgcccgta cccgccgggt cctcggtcgt gcgccggatc       780
     atcaccgtcg tcgtggacgg caggccggac cgggagaccg ccgcccggta cgcacgcgag       840
     gcggtggccc ggtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page