(data stored in ACNUC7421 zone)

EMBL: AP009493.PE219

AP009493.PE219       Location/Qualifiers
FT   CDS_pept        228493..229362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_219"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17048"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNM5"
FT                   /protein_id="BAG17048.1"
FT                   /translation="MVTGATGVLGRRVVDGLLGAGRPVRAVSRRPRRGALPPAVEAAVG
FT                   DVNEPSTLRTAFEGAGALVLVAVPDTAVEVVAYARAAGIEHIVVVSSAAVTAGHDTTYN
FT                   LPVERAVRESGLDWSIVRPGEFATNALLIWGPSIRSGRRVVEPFPDQSGSPIHEQDIAD
FT                   VIVADLLDPGRRGRIDTIVGPDALTKRDQVARIAEAVGVEIALDEVTPERALAFYREQG
FT                   GFAADNADWLYGFTSYDGVEGVTDEHREVDPGSDDAYLTLAEVLGRPGRSYAQWARDHA
FT                   GDFTGAAR"
     gtggtgaccg gggcgaccgg tgtgctcggg cggcgcgtcg tcgacggact gctgggcgcc        60
     ggtcggccgg tgcgtgccgt gtcccggcgg ccccgccgcg gcgccctgcc ccctgccgtg       120
     gaggcggcgg tcggcgacgt caacgagccg tcgacactcc gcaccgcctt cgagggggcc       180
     ggggccctgg tactcgtcgc ggtgcccgac accgccgtcg aggtggtcgc gtacgcgcgg       240
     gcggcgggca tcgagcacat cgtggtcgtg tcgtccgccg ccgtgaccgc aggtcacgac       300
     accacctaca acctgcccgt cgagcgcgcg gtgcgggagt ccgggctcga ctggtcgatc       360
     gtccggcccg gcgagttcgc caccaacgcg ctcctcatct gggggccgtc catccgctca       420
     ggccggcggg tggtcgagcc gttccccgac cagagcggca gcccgatcca cgagcaggac       480
     atcgccgacg tcatcgtcgc cgacctcctc gatcccgggc gtcgcggacg gatcgacacg       540
     atcgtcggac ccgacgcact caccaagcgc gaccaggtcg cccgcatcgc cgaggccgtc       600
     ggagtggaga tcgccctcga cgaggtgacg cccgagcggg cgctcgcctt ctaccgcgag       660
     cagggcggtt tcgccgccga caacgccgac tggctctacg gcttcaccag ttacgacgga       720
     gtggagggcg tcaccgacga gcaccgggag gtggaccccg gctccgacga cgcctacctc       780
     accctcgccg aggtcctcgg ccggccgggg cggtcctacg cgcagtgggc ccgcgatcac       840
     gccggcgact tcaccggggc cgcccgctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page