(data stored in ACNUC7421 zone)

EMBL: AP009493.PE220

AP009493.PE220       Location/Qualifiers
FT   CDS_pept        complement(229492..230964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_220"
FT                   /product="putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17049"
FT                   /db_xref="GOA:B1VNM6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNM6"
FT                   /protein_id="BAG17049.1"
FT                   /translation="MSSASRHPTPHAPAVIGIDVATASVRVVCVDGRGCVLAEARAELP
FT                   PPVRTVAGTSEQDARSWWPAVRTALRRTTGALPRGGREVTAVAVSATSGTIVPTGADGV
FT                   PLGPALMYDDRRAADLNAEAQRVGGARWDALGLSVGPTAALGRAVWCLRTYGRGLRHVL
FT                   HTPDLVGRALTGRPVATDWSHALKSGYDARAAEWAHEVFDAFDFPLALLPAVRAPATEA
FT                   GVVGREAAEATGLPEGCSVRLGMTDGCAGQIATGAVEPGRFVGVLGTTYVLKGVSAELV
FT                   HDATGAVYSHRHPDGWWLPGGASNTGGEWLADVDPARLPALDAAAAARGPASYVRYPLR
FT                   RDGERFPFVSGAARGFELGRPRDEADAHRAALEGVAFVERLALERVERLGVPVLGPLHA
FT                   AGGGSRSAVWTAIRATVLDRPVRVVDRAETAFGAALLAATGTLHEDLAAGAAAMVRGGA
FT                   LVDPVPGERSALDDAHGRFVAALRERGWISDG"
     atgagcagtg catcccgcca ccccacgccc cacgccccgg ccgtgatcgg catcgacgtg        60
     gcgaccgcgt ccgtccgcgt ggtgtgcgtg gacggacgcg gttgcgtgct cgccgaggcc       120
     cgtgccgaac tgccgccccc cgtacggacc gtcgcgggga cgagcgagca ggacgcccgg       180
     tcgtggtggc ccgccgtacg cacggcgctg cgccgcacca cgggcgcgct gccccggggc       240
     ggccgtgagg tgaccgcggt ggccgtgtcc gccacgtccg gcaccatcgt gcccaccggg       300
     gccgacggcg tcccgctcgg cccggccctc atgtacgacg accggcgggc cgccgacctc       360
     aacgccgagg cgcagcgggt gggcggcgcg cggtgggacg cgctcggcct gtccgtggga       420
     cccaccgcgg cgctgggccg agccgtctgg tgcctgcgga cgtacggccg gggcctgcgc       480
     cacgtcctgc acacacccga cctggtcggg cgcgcgctga cgggccgtcc ggtcgccacg       540
     gactggagcc acgcactcaa gtccggctac gacgcccgtg ccgcggagtg ggcgcacgag       600
     gtcttcgacg cattcgactt cccgctcgcg ctgctccccg ccgtacgcgc ccccgccacg       660
     gaggccggag tcgtcggccg ggaggcggcc gaggccacgg gcctgcccga agggtgctcc       720
     gtacgcctcg ggatgacgga cggctgcgcg ggacagatcg ccacgggggc ggtcgaaccg       780
     ggccggttcg tgggcgtgct cggcacgacg tacgtcctca aaggggtctc ggcggagctg       840
     gtccacgacg cgaccggggc ggtctacagc caccgccacc ccgacggctg gtggctcccc       900
     ggcggggcgt ccaacaccgg aggggagtgg ctcgccgacg tcgatccggc ccgcctgccc       960
     gcgctggacg ccgccgcggc ggcccggggc cccgcctcgt acgtgcggta cccgctgcgc      1020
     cgcgacggcg aacgcttccc cttcgtctcc ggcgcggcgc gcggattcga actgggccgc      1080
     ccccgcgacg aggcggacgc ccaccgggcc gcactcgaag gagtcgcctt cgtcgaacgc      1140
     ctggccctgg agcgggtcga acgactcggc gttccggtgc tcggccccct gcacgccgcc      1200
     ggcgggggca gccgcagcgc tgtgtggacg gcgatccggg ccaccgtcct ggaccgcccc      1260
     gtccgcgtcg tcgaccgtgc ggagacggcc ttcggcgccg cgcttctcgc ggcgacgggg      1320
     acgctccacg aggatctcgc ggccggcgcg gcggccatgg tgcgcggcgg cgccctcgtc      1380
     gatccggtgc cgggggaacg ctccgcgctc gacgacgctc acggccgctt cgtcgcggcg      1440
     ctgcgcgagc ggggctggat ctccgacggc tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page