(data stored in ACNUC7421 zone)

EMBL: AP009493.PE224

AP009493.PE224       Location/Qualifiers
FT   CDS_pept        233877..235349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_224"
FT                   /product="putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_224"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17053"
FT                   /db_xref="GOA:B1VNN0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN0"
FT                   /protein_id="BAG17053.1"
FT                   /translation="MSTIIGVDIGTSVTKAVAYDGAGGALASASRRSRLDMLPGGRVEQ
FT                   DLDDVVAGVGDVVREVAAAVGRTPDAVALTGQGDGLWLRDSGGLPVRPAISWMDGRAAE
FT                   LVTRWLVDGTISTAFAHTGSGMFPGCHGPLLNWLQEHEPDALDRAAVAGYCVDAVAQRL
FT                   TGRVCLDASDATLPFLDPRTRRYAPQALAACGIGDRAGLLPSPAAPGTVLALDGRGAGL
FT                   LGLPEGLPVVAGPYDLPACAIGSGVREVGDGVLILGTTLASQVLTDRVDLDPLAEPAGM
FT                   WLCTPSPGRWLRAMPAMVGTAALEWVLALVGATTADVDALLTDSPPGARGVHAFPFLSE
FT                   AGERAPFVDPSAQGRLDGLSLATGREDAVRAVCEAIGYAARHCLDTAGLSGTLALCGGG
FT                   TRSVLWARLIADVLGRPVRVPLEEQVGALGVVSVARSSLSPGYEAPPGRHRVVEPREGV
FT                   RALYEDGYERYRAELATARAAWGARARLSRRP"
     gtgagcacca tcatcggtgt ggacatcggg acgtcggtca ccaaggccgt ggcgtacgac        60
     ggggcggggg gcgccctggc ctccgcgagc cggcgctcgc ggctggacat gctgccgggc       120
     gggcgggtcg agcaggatct cgacgacgtc gtggccggtg tgggggatgt cgtgcgcgag       180
     gtcgccgccg cggtcggccg gacgccggac gccgtggcgc tcaccgggca gggggacggt       240
     ctgtggctgc gggactccgg gggcctgccg gtgcggcccg ccatctcgtg gatggacggc       300
     cgggccgcgg agctggtgac ccgctggctg gtggacggca cgatcagcac cgctttcgcg       360
     cacaccggct ccgggatgtt ccccggctgc cacggcccgc tgctgaactg gctccaggag       420
     cacgagcccg acgcgctgga ccgggccgcc gtcgcggggt actgcgtcga cgcggtcgcc       480
     cagcggctca ccggccgggt gtgcctggac gcgtcggacg cgacgctgcc gttcctcgac       540
     ccccgtaccc gccgctacgc gccccaggcc ctggccgcct gcgggatcgg ggaccgtgcg       600
     ggtctgctgc cgtcccccgc cgctccgggc acggtgctcg cgctggacgg tcgcggcgcg       660
     gggctcctgg ggctgcccga gggactgccg gtggtcgcgg ggccgtacga cctgccggcc       720
     tgtgcgatcg ggagcggcgt gcgcgaggtg ggggacggcg tcctcatcct cggcacgacc       780
     ctcgcgagcc aggtgctgac cgaccgcgtc gatctcgatc cgctcgccga gcccgccggc       840
     atgtggttgt gcacgccgtc ccccggccgc tggctgcgcg ccatgcccgc catggtggga       900
     acggcggcgc tggagtgggt gctcgcgctc gtcggcgcga ccacggccga cgtggacgcc       960
     ctgctcaccg acagcccgcc cggggcccgc ggcgtccacg ccttcccctt cctgtccgaa      1020
     gcgggtgaac gggccccgtt cgtcgatccg tcggcccagg gcagactcga cgggctcagt      1080
     ctggcgacgg gccgggagga cgccgtgagg gccgtctgcg aggccatcgg ctatgccgcc      1140
     cggcactgtc tggacacggc ggggctgagc ggcacgctcg ccctgtgcgg cggcggcacc      1200
     cggtcggtgt tgtgggcccg gctgatcgcc gacgtcctcg gccggcccgt ccgcgtacca      1260
     ctggaggagc aggtcggggc gctcggcgtg gtgtccgtcg cccggtcctc cctctccccg      1320
     gggtacgagg cgccgccggg acgccaccgg gtcgtcgaac cgcgtgaggg cgtacgggcg      1380
     ttgtacgagg acggatacga gcggtaccgg gcggagttgg cgacggcccg ggccgcatgg      1440
     ggagctcgcg cgcggttgtc ccggcgtccc tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page