(data stored in ACNUC7421 zone)

EMBL: AP009493.PE225

AP009493.PE225       Location/Qualifiers
FT   CDS_pept        235459..236538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_225"
FT                   /product="putative sugar ABC transporter sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_225"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17054"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN1"
FT                   /protein_id="BAG17054.1"
FT                   /translation="MKQRSVRSFAAVLSAMAVTVSAAACTTKAPTGSGGRSSEDAKIAF
FT                   LMPDIASTRYELYDAPLFKAKVKDLCGGCEVLYQNAGGDAAKQQQQADSALAQGADVIV
FT                   IDPVDSAAAAGTVRTAQGRGVPVIAYDRPIPAVEADYYVSFDNEKIGSMIGASLVEHLR
FT                   ATSAEGGLLQVNGSPTDAAAGLIKKGVHSAVDSSGFDLLAEYDTPAWEPGKAQSWVSGQ
FT                   IAKFRGRIAGVVAANDGTGGGSIAAFKAAGAAVPPVTGNDAELAAAQRIIKGDQYNTIS
FT                   KPIKTVAEAAADAAYAFARGEKPRGETELFGTPAQLFTPTVVTRENIAEVLVGDGKPLK
FT                   TAEVCTRTYAAACAEVGLA"
     gtgaagcaac gctctgtcag atcgttcgcc gctgtcctgt ccgcgatggc ggtgaccgtc        60
     tccgccgccg cctgtacgac gaaggcgccg accggctccg gcggcaggtc gtcggaggac       120
     gcgaagatcg cgttcctgat gcccgatatc gcctccaccc ggtacgagct gtacgacgcc       180
     cccctcttca aggcgaaggt gaaggatctc tgcggtggtt gcgaggtgct gtaccagaac       240
     gcgggcggcg acgccgcgaa gcaacagcag caggccgact ccgctctcgc gcagggcgcc       300
     gacgtcatcg tgatcgatcc ggtggactcc gcggcggcgg ccggcaccgt ccgtacggca       360
     cagggccgag gggtccccgt catcgcgtac gaccggccga tcccggcggt cgaggccgac       420
     tactacgtct ccttcgacaa cgagaagatc ggctccatga tcggggcgtc cctggtggaa       480
     cacctcaggg ccacctcggc cgagggcggc ctcctccagg tcaacggttc accgaccgac       540
     gccgcggcgg gcctgatcaa gaagggcgtg cacagcgcgg tcgactccag cggattcgac       600
     ctcctcgccg agtacgacac ccctgcctgg gaaccgggga aggcgcagag ctgggtcagc       660
     ggtcagatag ccaagttccg gggaaggatc gccggagtgg tcgccgccaa cgacgggacg       720
     ggcggcggtt ccatcgccgc gttcaaggcg gccggagcgg ccgtgccgcc ggtgaccggg       780
     aacgacgccg aactcgccgc cgcccagcgg atcatcaagg gcgatcagta caacaccatc       840
     tccaagccca tcaagaccgt cgcggaagcc gccgccgacg cggcgtacgc cttcgcacgg       900
     ggtgagaagc cccggggcga gaccgaactc ttcggcaccc ccgcacaact cttcaccccc       960
     accgtggtca cccgggagaa catcgcggag gttctggtgg gcgacgggaa gccgttgaag      1020
     accgccgagg tgtgcacgcg gacgtacgcc gccgcgtgtg ccgaggtcgg cctcgcgtag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page