(data stored in ACNUC7421 zone)

EMBL: AP009493.PE226

AP009493.PE226       Location/Qualifiers
FT   CDS_pept        236649..237509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_226"
FT                   /product="putative sugar ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_226"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17055"
FT                   /db_xref="GOA:B1VNN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN2"
FT                   /protein_id="BAG17055.1"
FT                   /translation="MPADSPPSPHEGPGGPLLSLRGISKSFGAVAALTDVDLDVAAGRV
FT                   VALVGDNGAGKSTLVKILSGVHRPDAGTIGFGAETVAITSPATAQRLGIATVFQDLALC
FT                   ENLNVVENLFLGRELRGLRLDEVGMEVRSRALLGELSAKIPSVRVPVAALSGGQRQTVA
FT                   IARTLLGDPKVIILDEPTAALGVAQTAEVLNLIERLRERGLGVLMVSHNMADVRAVADT
FT                   VAVLRLGRNNGVLDAAGTTASQLVAAITGAADNVVSRRAGRDRATADGTESAYGAGAAQ
FT                   QGEAS"
     atgcccgctg actccccacc ctccccgcac gaggggccgg gcggcccgct gctctccctg        60
     cgcggaatca gcaaatcctt cggcgccgtc gccgcgctca ccgatgtgga cctcgacgtc       120
     gccgcggggc gggtggtggc tctggtcggc gacaacggcg cggggaagtc caccctggtg       180
     aagatcctct ccggggtgca ccggccggac gccggaacca tcggtttcgg cgccgaaacc       240
     gtggcgatca cctccccggc caccgcccaa cggctcggca tcgcgaccgt gttccaggac       300
     ctggccctgt gcgagaacct gaacgtggtg gagaacctct tcctcgggcg cgagttgcgc       360
     gggctgcggc tggacgaggt gggcatggag gtccgctccc gcgctctgct cggggagctg       420
     tcggcgaaga tcccctcggt acgcgtgccg gtcgcggccc tgtccggcgg ccagcgccag       480
     acggtggcca tcgcgcggac cctcctgggc gacccgaagg tgatcatcct ggacgagccg       540
     acggcggccc tgggcgtggc gcagacggcg gaagtcctca atctgatcga gcgcctgagg       600
     gagcgtggcc tgggcgtcct catggtcagc cacaacatgg ccgatgtgcg ggccgtcgcc       660
     gacacggtgg ccgtcctgcg gctcggccgc aacaacgggg ttctcgacgc ggccgggacg       720
     acggcgtcgc agctggtggc ggccatcacc ggggccgccg acaacgtggt cagccgccgc       780
     gccggccgcg accgggccac ggccgacggc acggagtcgg cgtacggggc cggagcggcc       840
     cagcaggggg aggcgtcatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page