(data stored in ACNUC7421 zone)

EMBL: AP009493.PE227

AP009493.PE227       Location/Qualifiers
FT   CDS_pept        237506..238771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_227"
FT                   /product="putative sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_227"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17056"
FT                   /db_xref="GOA:B1VNN3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN3"
FT                   /protein_id="BAG17056.1"
FT                   /translation="MTEPAAVTNPGPRPDDPLSPLGQKPRPAGARDRLRAASGRLRGGD
FT                   LGLLPVLAGLVVIWVVMQILDPLFLSSANLTNLALESVPVGVIALGVVCVLLVGQIDLS
FT                   VGSISGLGAAVLAVLFVDRGLPAWLAVAVALALAGLIGWLYAQVHNRIGVPSFVITLGG
FT                   LLGFLGVQLWILGPKGSINLPFDSGLVTFAQLHFLPPWLAYTLVAAGAVVLYATGAARA
FT                   SERRRAGLAAASRRLLAGRSLALLAGLGAAVWYLNRDRGVGWMFVFFLALVLALHYVLS
FT                   RTAFGKSMYAVGGNLEAARRAGVNVKAVLTTAFVLCATLACVGGVLSAARLAAANQSSG
FT                   GGDVNLNAIAAAVIGGTSLFGGRGTAFAALLGVLVIQSISSGLTLLNLDSAYRFMVTGG
FT                   VLLLAVSLDAVARRSRVSHGRA"
     atgacggaac cggccgctgt cacgaatccc gggccccggc ccgacgatcc cctcagcccc        60
     ctcgggcaga agccccgccc cgccggtgcg cgggaccgtc tgcgggcggc gtccggccgg       120
     ctgcgcggcg gcgacctcgg tctcctgccc gtcctcgccg ggctggtggt gatctgggtc       180
     gtgatgcaga tcctcgaccc cctcttcctg tccagcgcga atctcacgaa cctcgccctc       240
     gagagtgtcc cggtcggcgt catcgccctg ggagtcgtct gcgtcctgct cgtcgggcag       300
     atcgatctgt cggtcggctc gatcagcggc ctcggcgcgg ccgtactggc ggtcctcttc       360
     gtggaccggg ggctgccggc ctggctcgcc gtcgcggtcg cgctggccct ggcgggtctg       420
     atcggctggt tgtacgccca ggtccacaac cggatcgggg tacccagctt cgtgatcacc       480
     ctcggcgggc tcctcggatt cctcggcgtg cagctgtgga tactcgggcc caagggatcg       540
     atcaacctgc cgttcgactc gggcctggtg accttcgccc aactccattt cctgcccccg       600
     tggttggcgt acacgctggt cgccgcgggc gcggtcgtgc tgtacgcgac cggtgccgcc       660
     cgggcgtcgg agcgacgccg ggcggggctc gccgccgcct cccggcgcct gctcgccgga       720
     cggagtctgg cgctgctggc cggcctcggc gcggcggtct ggtatctcaa ccgggaccgg       780
     ggggtgggct ggatgttcgt gttcttcctc gctctggtgc tggcgctgca ctacgtcctg       840
     tcccgcaccg ccttcggcaa gtcgatgtac gcggtcggtg gcaacctgga ggccgcccgg       900
     cgtgcggggg tgaacgtgaa ggccgtcctc accacggcgt tcgtgctgtg cgcgacgctc       960
     gcgtgcgtcg gcggcgtcct ctcggcagca cgcctcgccg cggccaacca gagcagcggc      1020
     ggcggtgacg tcaacctgaa cgccatcgcg gcggccgtca tcggcggcac cagtctgttc      1080
     ggcggccggg gcaccgcgtt cgccgcgctg ctcggggttc tcgtgatcca gtcgatctcc      1140
     agcgggctca cgctgctcaa tctcgactcc gcgtaccgct tcatggtgac cggcggcgtg      1200
     ctgctgctcg cggtgtcgct ggatgccgtg gcccggcgtt cgcgggtctc ccacggcagg      1260
     gcctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page