(data stored in ACNUC7421 zone)

EMBL: AP009493.PE229

AP009493.PE229       Location/Qualifiers
FT   CDS_pept        240673..241224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_229"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17058"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN5"
FT                   /protein_id="BAG17058.1"
FT                   /translation="MTPQALERATLSGKESNFEAKKVAKADVEAGRDMRADKAECQPLA
FT                   SLAGGYTHIPAVAVEHRALEPVETTNATVGSMWLASHSERNAKKVLAEVRTSLQECPDG
FT                   FRTLGLTYTSVKAVKAPALGDEAVGYRITNVVGKQKVSMTYTLVRKDGVVAVFYGVNML
FT                   TPEKSAIPDSVVRGQMEKLG"
     atgaccccac aggccctcga aagagccacg ctctccggaa aggagagcaa cttcgaggcc        60
     aagaaggtag ccaaggcgga tgtcgaagca ggccgcgaca tgagggcgga caaggccgag       120
     tgtcagccgc tggcgagctt ggccggcggc tacacccaca tccccgcggt ggcggtcgag       180
     caccgcgccc tcgaacccgt cgagacgacg aacgcaaccg ttggatcgat gtggctcgct       240
     tcgcactcgg agcggaatgc caagaaggtc ctggcggagg tgcggacctc tctccaggag       300
     tgtcccgacg gcttcagaac tctgggactg acctacacgt cggtcaaggc ggtcaaggcg       360
     ccggctctgg gtgacgaggc cgtcggctac cgcattacca acgtggtcgg aaagcagaag       420
     gtcagcatga cgtacaccct ggtccgcaag gacggcgtgg tcgcggtctt ctacggggtc       480
     aacatgctga ccccggagaa aagcgcgatc cccgattcgg tcgtccgcgg ccagatggag       540
     aagctgggct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page