(data stored in ACNUC7421 zone)

EMBL: AP009493.PE23

AP009493.PE23        Location/Qualifiers
FT   CDS_pept        complement(28385..29173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_23t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_23t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16852"
FT                   /db_xref="GOA:B1VKM6"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM6"
FT                   /protein_id="BAG16852.1"
FT                   /translation="MVQEEIEADPQLRRQLQLQLTAPGTNATGSLLITDSQVSRSTIAL
FT                   GPLTINNTRSGRAVIALVAALLLALVVLAVYGGTRLIMVDDSPKSSQDYSARHAVRTLD
FT                   VSEVKRVVPDLTSMPSGWERSGSLEAGKDEETGCSGAQERFSTNNWNDGSTRTVWAEFT
FT                   VQSCPSAALTAKGFEETRSGVANNNKASEISLPELGDQRAAITHYNADLDETTAVALVR
FT                   VGTVLVELEYDPVPDDPGWSREFGQLASMVAARAQQVQNA"
     gtggtgcagg aggagatcga ggcggacccg caactgcggc gtcagctgca actgcagctg        60
     accgcaccgg gaacgaacgc cacgggcagc ctgttgatca ccgacagcca ggtgtcacgc       120
     agcaccatcg ctcttggccc gctgaccatc aacaacaccc ggagcgggcg ggccgtcatc       180
     gccctggtgg ctgctctgct gctggccctg gtcgtgctgg ccgtgtacgg gggcacacgg       240
     ctgatcatgg tcgacgactc ccccaagtcg tcgcaggact acagcgcccg ccatgccgtg       300
     cgaaccctgg acgtcagtga ggtcaaacgg gtcgttccgg acctgacgag catgccctcc       360
     ggatgggaga gatccggttc cctcgaggcg ggcaaggacg aggaaaccgg gtgctcaggg       420
     gctcaggagc gcttcagcac gaacaactgg aacgacggca gcacgaggac ggtctgggcc       480
     gaattcacgg tccagtcctg ccccagtgcg gcactgaccg cgaagggttt cgaggagacc       540
     cggtcgggcg tcgccaacaa caacaaggcg agcgagatct ccctcccgga gctcggtgac       600
     cagcgcgccg cgatcaccca ctacaacgcc gacctcgacg agacaacagc tgtcgccctg       660
     gtacgcgtcg gcaccgtcct cgtcgagctg gaatacgacc cggtgcccga cgacccgggc       720
     tggtctaggg agttcggaca gttggcctcg atggtcgccg cccgcgccca acaggtccag       780
     aacgcctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page