(data stored in ACNUC7421 zone)

EMBL: AP009493.PE230

AP009493.PE230       Location/Qualifiers
FT   CDS_pept        complement(241418..241924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17059"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN6"
FT                   /protein_id="BAG17059.1"
FT                   /translation="MRSHAPDAAEPALRADGAPFTTRPSGKKMVVMTDFIREGRLFRVI
FT                   GFLPSHRQLFLASEATLVDRTTTRVEVSFGHVELMFLKPFYRNGLHIRRATEAEFGLLG
FT                   ERHGIPAEDAAYTWMLERDGDSFVVAGRPSWREAEYALMGERESLYDPREPWPPDFPAE
FT                   SGQVG"
     gtgcgatcgc acgcaccgga cgccgccgag cccgccctcc gggcggacgg cgctcctttc        60
     acaacacgcc ccagtgggaa gaagatggtg gtcatgacgg atttcatccg ggagggacgg       120
     ctcttcagag tcatcggttt cctcccctcg caccggcagt tgttcctggc cagtgaggcc       180
     acgctggtgg accggaccac gacccgggtc gaggtctcct tcgggcatgt ggagctcatg       240
     ttcctcaagc ccttctaccg gaacgggctt cacatccggc gggcgaccga ggccgagttc       300
     ggcttgctcg gcgaacggca cggcattccg gcggaggacg ccgcctacac gtggatgctg       360
     gagcgcgacg gcgacagctt cgtcgtcgcc ggccggccgt cctggcggga ggccgagtac       420
     gcgttgatgg gcgagcggga gtcgttgtac gacccgcgtg agccctggcc gccggacttc       480
     ccggcggaat ccgggcaggt cggctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page