(data stored in ACNUC7421 zone)

EMBL: AP009493.PE231

AP009493.PE231       Location/Qualifiers
FT   CDS_pept        complement(242028..249323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_231"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17060"
FT                   /db_xref="InterPro:IPR029112"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN7"
FT                   /protein_id="BAG17060.1"
FT                   /translation="MIQAVPAVADPPAEEDTGVSRNSIGEDPRRDRCLAGVALHVGGPR
FT                   MKAKAIEALTGTDEQLREAIGDIGWIGYGPIGMEGIADKEDGSAYREAGDRRRAELNEA
FT                   NKPYRESAWTDEGMDFHAPDFGANVSYFTALAQVQLASPLGWDGHSEASDEAIARARVI
FT                   ADENDGKDDWHDFAAHLMLRDVGYEYSGGTTSSDIAAYLRRGGFATDAPVKDTAEYNVE
FT                   VEDLKQAWAACDYQNPIDPRRVLNAPVMTAMVDWELEYAGQADQRATIIQAEADAAAAT
FT                   QAATGDMIEAIRQAWIVEQILTWRKYWQDAAANGIDMSDKPDQAFYDKATADQNAARTK
FT                   VAALVVSAKAQAAKAATAAQKAATAQQEAWAVADAARTPRGRGLMYAQQSVQVARASAA
FT                   ATAAAAKATETALAAANATIADADALLAKAQTDSHAISTEFRRVAAEEAASQAKAAADS
FT                   AEANAQGAAASAKRAKDARTTAEQKRDKAEDAATTAASERAKAQAEKANAVASRAEAAI
FT                   EREKAQKAQQRAATEQTTAKSADTAAETASADATAKRKLATEKAKAAQTAREKAVAATQ
FT                   AKQATAARAAALEAAATAAAGTAAAAETRAAATAARTAASQAAQASTAAQTAADQATTA
FT                   AVGARSAATTAEGAARRAEANAGKAWSAYRTSLGAASSAHAAAAVALDASQDAALRAEN
FT                   AATASQNATKLAEKAEQESAAAVTSAADAVKSAATVVGRAYAAGQAALAARDSAKEATA
FT                   ASSEAIAAGTPYRVKDSSAAFAVLVGQSSKTIAEQQAAAAEAKATEAAAASDSARQAAA
FT                   QATGDAKLAAEAAARAASDSVRAVEAVTRAQTSAADAAGDQKGAKKASDAAAGHSQQAG
FT                   DDAAKAQLVANETNTTAIEADREATDAERHAAEANEKADRAGEAAKGAQDKATEAEKEA
FT                   KAAEDKASDATGDSTAAEEAAKKAEQEQREKNEAAHKDALAEGVTPIKGGAANWPVLGD
FT                   REEKILLDACGRTCVDDYREGLAAVSVDIVAWATANGGQILFEQLDAADVKQCLAGYDV
FT                   EDCLWDLVDITSSAVIVGRMPALAQAVEKVSEGVRKIFVDADNAQRRLGELTAVISDVR
FT                   STPRLNRCLAGVALHAGGAKMKAKAIEGLTGTNDQLDAVIGDVGWIGFMPLGQARDQDS
FT                   EAAMAFRDAMAAREALLEDANRPYAMSSFDDGITLHTPEFGEDILGFTLASQAKLSQRL
FT                   GWDDHTNASAEALAKAGEITEQNRGKDSWHDAEADVMLRYSNVSNTRFSGGTTSADVAT
FT                   YLRHGGFLGKKVTEDSAGFRIEVETLKQAWAECNHQDPVDPRNGLSEVVSQASAEWETE
FT                   YAGQAAPRAVIMQAEADAAAATRAAADTMVEAIGQAWFADQILRWQKYWQDQLKIDPDH
FT                   LFKPKQALFDRAKSDLAKARGKVQVLVTASKQQAAAANAAAQRAVTAQQQAWTIADAAE
FT                   VPRGRGLVYAQQSVQVARASGAAATAAAKATETALNAANATVSTSHALLALAQTQTHAV
FT                   KTEFARIAAQEAASQAKVAADSAEAYAASAAANAATAKKAKETAAAEEEEARQAAADAQ
FT                   RSRGVAELERANAAAYRATAESERDKAAGHEADAVAQGRLAGDARTSAEASAATASDRR
FT                   ANAEKAEKDAVAARDKALEAEQRRDSLKAKAAAKEAHAAAMEGTDAAEAARAAATDARS
FT                   AANTATTAATNARASANAATAAATNAREAATKAQGAASRAKAASDATWASYLVAAGSAA
FT                   SAHAAAAEAIDASEAAALDAKGAKEQSEKASTAARTAKKEAATAHSEALKTAAWAATTA
FT                   GKALAAVQSSLAARDSAAAVIKPANEAISLGGPYQETDSSAAFAVLTGQQSLTLSQQQA
FT                   AAAAATATLAEGFSAEAKALAAQAAADMKLAAQASAAAATDAVRAAKAYTRAQSSAAQA
FT                   AADSKLAQASAKRADGYAESAGQDVARAWTASNDAQLDAIAADSAATEAEKDAASARAA
FT                   ATRAEEDAAGARGAATRAEADATAAEKAAEGAWDAANEAQEAADRTEKGGNTEQITQGV
FT                   TTGISGVWAVLDRIEYIGEPRNVVKDNCNPIIHVGDCTITSDVTYKSHVDLFMCMATPD
FT                   SYSGSCPAADTVYLGPEVSEPTTKRLSYTLTMVEFNSGIDPVDVLLGDFIGCAKLITPG
FT                   VSGGSWGDCAWAASWFVAGVIFRSAKAAVTAMDAAMRTGIGFMDAYRALRTIGLTEAAV
FT                   QGIISRLLRMAAEACETVNTPKTFKVAAFSLASADSEVVKKCAALLKDLVKDGDHIVLG
FT                   INPHSDDLAASIGASTFNNKAYGTNLPAAMGLGERPIWTVGVERSVENPKVRISVTLDG
FT                   VAGAKNADEALTLLLQRGETIEKSDWKVIRTGGFGTAWEMIKLRTALRMEYRKWDSIEW
FT                   HMTNSKGDVVRVYPTRMTYANGTPVD"
     gtgatccagg ccgttcccgc cgtggctgac ccgcccgccg aggaggacac cggggtcagc        60
     cgcaacagca tcggcgagga tccccgacgc gaccgctgcc tcgccggtgt ggcgctgcac       120
     gtcggcggtc cccggatgaa ggccaaggcc atcgaggccc tgaccggcac cgacgagcaa       180
     ctccgcgagg ccatcggcga tatcggctgg atcggctacg gccccatcgg catggaagga       240
     atcgccgaca aggaggacgg cagcgcctac cgggaggccg gcgaccggcg gagagccgag       300
     ctcaacgagg ccaacaagcc ctatcgcgag tccgcgtgga ccgatgaggg catggacttc       360
     cacgcacccg acttcggtgc gaacgtgagc tacttcaccg ccctcgcgca ggttcagctc       420
     gcctccccgc tcgggtggga cggccacagc gaggccagtg acgaggcgat cgcgcgggcc       480
     cgcgtgatcg ccgacgagaa cgacggcaag gacgactggc acgacttcgc ggcgcacttg       540
     atgctgcgag acgtcggata cgagtactcg ggcggcacca catccagcga catcgccgcc       600
     tatctgcggc gcggtggatt cgcgaccgat gccccggtca aggacacggc cgagtacaac       660
     gtcgaggtcg aggacctgaa gcaggcctgg gctgcctgcg attaccagaa cccgatcgac       720
     ccgcggcgcg tactgaacgc accggtcatg accgcgatgg tcgactggga gctggagtac       780
     gcggggcagg ccgaccagcg ggccacgatc atccaggcgg aggcggacgc cgccgcggcg       840
     acccaggccg cgaccggcga catgatcgag gccatcaggc aggcctggat cgtcgagcag       900
     atcctgacct ggcggaagta ctggcaggac gccgccgcca acggcatcga catgtccgac       960
     aagcccgacc aggctttcta cgacaaggcc acggccgatc agaacgccgc ccgcaccaag      1020
     gtggccgccc tggtcgtctc ggccaaggcg caggctgcca aggcagccac cgccgcccag      1080
     aaggccgcga ccgcgcagca ggaggcatgg gccgtcgccg acgccgcccg cacgccgcgc      1140
     gggcgtggtc tgatgtacgc ccagcagtcg gtccaggtgg cccgtgcctc ggctgccgcc      1200
     accgcggccg ccgcgaaggc cacggagacc gcgctcgctg cggccaacgc gacgatcgcc      1260
     gacgcggacg ccctgcttgc caaggcgcag acggactccc acgcgatcag caccgagttc      1320
     cgtcgcgtgg ccgccgagga ggccgcctcc caggcgaagg ccgccgccga cagtgccgag      1380
     gccaacgccc agggcgccgc cgccagtgcg aagagggcca aggacgcccg tactacggcg      1440
     gagcagaagc gcgacaaggc agaggacgcc gccaccaccg ctgcttccga acgcgccaag      1500
     gcacaggccg agaaggccaa cgccgtcgca tcccgtgccg aggccgccat cgagcgggaa      1560
     aaggcgcaga aggcccagca gcgggcggcg accgagcaga ccacggccaa gagtgccgac      1620
     accgctgccg agaccgcgtc cgccgacgcg acggcgaagc gcaagctcgc caccgagaag      1680
     gcgaaggctg cgcagaccgc acgcgagaag gccgttgccg cgacccaggc caagcaggcc      1740
     accgcggccc gcgcagccgc cctcgaagcc gcggccaccg ccgccgcggg cacggcggcc      1800
     gccgccgaga cccgggccgc ggccaccgcc gcacgcacgg cggcgagcca ggccgcccag      1860
     gcctcgaccg ccgcgcagac cgctgccgac caggccacca ccgccgccgt cggtgcgcgg      1920
     agcgccgcga ccacggcgga gggcgcagcc aggcgggccg aggccaacgc cggtaaggcg      1980
     tggtcggcgt accgcacctc cctcggcgcg gcatcctccg cccacgcggc cgccgccgtc      2040
     gccctcgacg cgtcgcagga cgccgcgctc cgcgcggaga acgccgccac ggcatcgcag      2100
     aacgccacga aactggccga gaaggcggag caggagtccg ctgccgccgt gacgagcgcg      2160
     gccgacgccg tcaagtctgc cgcgaccgtc gtcggtcgcg cctacgccgc cggacaggcg      2220
     gcgctcgccg cgcgcgacag cgcgaaggaa gccacagccg cttccagcga agccatcgcg      2280
     gcggggaccc cgtaccgggt gaaggacagc tcggctgcct tcgccgtcct ggtcggtcag      2340
     tcgtccaaga cgatcgcgga gcagcaggcc gcggccgccg aggccaaggc caccgaggcg      2400
     gcagcggcgt ccgattccgc gcggcaggcc gccgcgcagg cgacgggcga cgccaagctg      2460
     gcagcagagg ccgccgcacg cgcggcgagt gattcggtcc gggccgtcga ggccgtgacc      2520
     cgcgctcaga cgtccgccgc cgacgcggcc ggcgaccaga agggcgccaa gaaggcgtcc      2580
     gacgccgccg ccgggcactc ccagcaggcc ggcgatgacg cggccaaggc ccaactcgtc      2640
     gcgaacgaga cgaacaccac ggccatcgag gcggaccgtg aggcgacgga cgccgaacgg      2700
     cacgccgccg aggcgaacga gaaggccgac cgggccggtg aggccgccaa gggagcccag      2760
     gacaaggcga ccgaggcgga gaaggaggcc aaggccgccg aggacaaggc gtccgacgcc      2820
     acgggcgaca gcaccgcggc cgaggaggcc gcgaagaagg ccgagcagga acagcgcgag      2880
     aagaacgagg ccgcgcacaa ggacgcactc gccgagggcg tcacacccat caagggcggt      2940
     gccgccaact ggcccgttct cggggaccgc gaggagaaga tcctcctcga cgcgtgcggc      3000
     cggacctgtg tcgacgacta ccgcgagggc ctcgcggccg tctcggtgga catcgtcgcc      3060
     tgggcgacgg ccaacggcgg ccagatcctc ttcgaacagc tcgatgccgc cgacgtgaag      3120
     cagtgcctgg cggggtacga cgtcgaggac tgcctctggg acctcgtcga catcacctcc      3180
     tccgccgtga tcgtcggccg tatgcccgca ctcgcccagg cggtcgagaa ggtctccgag      3240
     ggggttcgga agatcttcgt cgacgccgac aacgcacagc gccggctcgg cgaactgacc      3300
     gccgtcatca gcgatgtccg ctccaccccg cggctgaacc ggtgcctcgc gggggtcgcc      3360
     ctgcacgcgg gcggcgccaa gatgaaggcc aaggccatcg agggcctgac cgggaccaac      3420
     gatcagctgg acgccgtcat cggtgacgtc ggctggatcg ggttcatgcc cctggggcag      3480
     gccagggacc aggacagcga ggccgccatg gccttccgtg acgccatggc cgcccgcgag      3540
     gctctcctgg aggatgccaa ccggccgtac gcgatgagct cgttcgacga cgggatcacg      3600
     ctgcacacgc cggagttcgg cgaggacatc ctcggcttca ccctggcctc gcaggcgaag      3660
     ctgtcccagc gtctgggctg ggacgatcac accaacgcca gcgccgaggc actggcgaag      3720
     gccggggaga tcaccgagca gaaccgcggc aaggacagct ggcacgacgc cgaggcagac      3780
     gtcatgctcc ggtactcgaa cgtgagcaac acccggttct ccggcggtac gacgtccgcc      3840
     gacgtcgcga cctacctgcg gcacggcggc ttcctcggca agaaggtcac cgaggacagt      3900
     gcggggttcc gcatcgaggt cgagaccctc aagcaggcat gggcggagtg caaccaccag      3960
     gatccggtgg acccgcgcaa cggtctgagc gaggtcgtct cgcaggcctc ggccgagtgg      4020
     gagacggagt acgccggcca ggccgccccg cgcgcggtca tcatgcaggc ggaggccgac      4080
     gccgccgccg cgacccgggc cgccgccgac accatggtcg aggccatcgg ccaggcctgg      4140
     ttcgccgacc agatcctgcg gtggcagaag tactggcagg accagctcaa gatcgacccg      4200
     gaccacctct tcaagccgaa gcaggccctc ttcgaccggg cgaagagcga cctcgcgaag      4260
     gcgcggggca aggtccaggt gctcgtcacc gcctccaagc agcaggccgc cgccgccaac      4320
     gccgccgccc agcgcgcggt gacggcccag caacaggcct ggacgatcgc ggacgccgca      4380
     gaggtgcccc gcggccgcgg tctcgtctac gcccagcagt cggtccaggt cgcccgcgcc      4440
     tccggcgcgg ccgccacggc cgccgcgaag gccacggaga cggccctgaa cgcggcgaac      4500
     gccaccgtct cgacgtccca cgccttgctg gccctggcgc agacccagac gcacgcggtg      4560
     aagaccgagt tcgcccgtat cgccgcccag gaggcagcat cccaggcgaa ggtcgccgcg      4620
     gacagcgcgg aagcctacgc cgcctccgcc gcggcgaatg cggcgaccgc caagaaggcc      4680
     aaggagaccg ccgccgcaga ggaggaggag gcccgtcagg ccgctgccga cgcgcagcgt      4740
     tcgagaggtg tcgccgagct cgagcgcgcc aacgcggccg cctaccgggc gaccgcggag      4800
     agcgaacggg acaaggcagc cggccacgag gcggacgccg tcgcgcaggg caggctcgcc      4860
     ggtgacgccc gtacctccgc cgaagcgtcg gcagccacgg cttcggaccg cagggccaac      4920
     gccgagaagg cggagaagga cgcggtagcc gcccgcgaca aggccctgga ggccgagcag      4980
     cgacgggact cgctcaaggc caaggcagcg gcgaaggagg cgcacgccgc cgccatggaa      5040
     ggtacggacg ccgctgaggc cgcccgtgcc gccgccaccg acgcccggag cgccgccaac      5100
     acggccacca cggccgccac caacgcgcgg gcgtcggcga acgcggccac ggccgccgcc      5160
     accaacgccc gggaggcggc caccaaggca cagggcgcgg catcccgcgc caaggcggca      5220
     tccgacgcca cctgggcctc ctacctggtg gcggccggtt cggccgcgtc agcccacgcc      5280
     gcggcagcgg aggccatcga cgcctccgag gccgcggccc ttgacgccaa gggcgccaag      5340
     gaacagtccg agaaggcatc cacagcggcc aggacagcca agaaggaggc agccaccgcc      5400
     cacagcgagg cgctgaagac cgcggcctgg gcagcgacca ccgccggcaa ggcgctcgcc      5460
     gccgtccagt cgtccctcgc cgcccgtgac tccgcggcgg cggtgatcaa gcccgccaac      5520
     gaggcgatct cgctgggcgg cccgtaccag gagaccgaca gttccgccgc gttcgccgtc      5580
     ctcaccggcc agcagagcct gacgctctcc cagcagcagg cagcggcggc agccgccacg      5640
     gccaccctgg ccgagggctt ctccgccgag gcgaaggccc tcgcagccca ggctgcggcc      5700
     gacatgaagc tggcggccca ggcatcggcg gcagcggcga ccgacgccgt tcgtgccgcc      5760
     aaggcctaca cgcgtgccca gtcctcagcc gcccaggccg cagcggactc aaagctggcc      5820
     caggcctcgg cgaagcgagc cgacggctac gccgagtcgg ccggccagga cgtggcaaga      5880
     gcctggacgg cgtcgaacga cgcccaactg gacgcgatcg cggcagacag cgccgccacc      5940
     gaagcggaga aggatgccgc ttcggcccgt gcggcggcca ccagggccga ggaggacgcg      6000
     gccggtgcac gcggcgccgc cacccgggcg gaggccgacg cgacagcggc cgaaaaggcc      6060
     gccgaaggtg cgtgggatgc ggcgaacgag gcccaggaag ccgcggaccg cacggagaag      6120
     ggtggcaaca ccgagcagat cacacagggt gtcaccaccg ggatcagcgg ggtgtgggcg      6180
     gtcctcgacc gcatcgagta catcggcgag ccgcgtaacg tcgtcaagga caactgcaac      6240
     ccgatcatcc acgtcggcga ctgcacgatc acgtccgacg tcacgtacaa gtcgcacgtc      6300
     gacctgttca tgtgcatggc gacgccggat tcctactccg gcagttgccc cgccgcagac      6360
     accgtctacc tcggccccga ggtgtccgag cccacgacca agcggctgtc gtacacactg      6420
     acgatggtcg agttcaactc gggcatcgac ccggtcgacg tgctcctcgg ggacttcatc      6480
     ggctgcgcca agctgatcac cccgggcgtg tcgggcggca gctggggcga ctgcgcctgg      6540
     gcggcgagct ggttcgtcgc cggtgtgatc ttccggtcgg cgaaggccgc ggtgacggcg      6600
     atggacgccg ccatgaggac gggcatcggg ttcatggacg cctatcgggc gctccgtacc      6660
     atcggcctga ccgaggccgc cgtccagggc atcatcagcc gtctcctccg gatggccgcc      6720
     gaggcgtgcg agacggtgaa caccccgaag accttcaagg tcgcggcgtt ctccctcgcg      6780
     tcggccgact cggaggtcgt caagaaatgc gccgcgctcc tcaaggatct ggtgaaggac      6840
     ggtgatcaca tcgtcctcgg aatcaacccc cactcggatg acctggccgc ttccatcgga      6900
     gcgtccacgt tcaacaacaa ggcgtacggg accaacctgc cggcggccat gggcctgggc      6960
     gagcgcccca tatggacggt gggggtggag cgatcggtgg agaaccccaa ggtgaggatc      7020
     tcggtgaccc tggacggtgt cgccggcgcc aagaacgccg acgaagcgct gaccctgctc      7080
     ctgcagcgag gggagacgat cgaaaagagc gactggaagg tcatccggac cggtggcttc      7140
     gggaccgcat gggagatgat caagctccgt acggccctcc ggatggagta ccgcaagtgg      7200
     gacagcatcg agtggcacat gaccaacagc aagggcgacg tcgtacgggt ctacccgacg      7260
     cgcatgacgt acgccaacgg gactccggtg gactga                                7296
//

If you have problems or comments...

PBIL Back to PBIL home page