(data stored in ACNUC7421 zone)

EMBL: AP009493.PE232

AP009493.PE232       Location/Qualifiers
FT   CDS_pept        complement(249846..250583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_232"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17061"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNN8"
FT                   /protein_id="BAG17061.1"
FT                   /translation="MVPPESAVPADQSGNQCRRAPTGLRCHVSRRVRGAVDVANGLRWI
FT                   STAYDLGYTFTLCEGIGPRDLLARMGAEPHHLHELSDDVVAELQMRPEDGHLSDLDFLD
FT                   REDESLVARLTEAGFLSHPAVLVRAGAVPGWAYAIENITSRAPAHLAALSHGTRVYTVF
FT                   RSVNGEHEVGYAVNGRVLAYYQPQVGHSAGAGGEPGVPGFGYCGEEPPDVAFLRFLERE
FT                   HGIHVSWEAFQAPLPTAAFARGS"
     gtggttcctc cggagtcggc cgttcccgcc gaccagagcg ggaaccagtg tcgccgggcg        60
     ccgactgggc tacgttgcca cgtgagtcgg cgagtgcgag gagcggtgga cgtggcgaac       120
     gggttgcgat ggatatccac cgcgtacgac ttgggttaca ccttcacgct gtgcgaaggc       180
     atcgggccgc gggatctgct ggcgcggatg ggagcggagc cgcatcacct ccacgagctg       240
     tccgacgacg tggtggccga actccagatg cggccggagg acggccacct gagtgacctg       300
     gactttctcg accgggagga cgagagcctg gtggcccggc tgacggaggc cggattcctc       360
     tcacatccgg cggtgctcgt tcgcgcgggc gccgttcccg gctgggccta cgcgatcgag       420
     aacatcacca gccgtgcccc tgcccacctg gcggcgctgt cgcacggcac tcgcgtgtac       480
     accgtgttcc gcagcgtgaa cggcgaacac gaggtcggct atgccgtcaa cggcagggtg       540
     ctggcctact accagcccca agtggggcat tcggcaggcg ccggcggcga gccgggggtg       600
     ccgggcttcg ggtattgcgg tgaggaacct cccgacgtcg ccttcctccg tttcctcgaa       660
     cgcgagcacg gaatccacgt ctcgtgggag gccttccagg ccccgcttcc caccgccgcc       720
     ttcgcccggg gcagttga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page