(data stored in ACNUC7421 zone)

EMBL: AP009493.PE241

AP009493.PE241       Location/Qualifiers
FT   CDS_pept        257909..258361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_241"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17070"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP7"
FT                   /protein_id="BAG17070.1"
FT                   /translation="MAVREGYRYCRGGEHVSWPDVIILVPVEQRPALEGRIRTLGRLVP
FT                   DPVTGCERLYRNGFSYALDLSGRILAEYEPDELDQVTALVGAPYAVHVSCQSMEAARTL
FT                   LREVLPGVDGLVDTNHFEILPVSGFLGLLARHPEWDWRRRPSTELP"
     gtggcggtcc gggaggggta ccgatactgc cgtggaggtg aacacgtgtc ctggccggat        60
     gtcatcatcc tcgtccccgt ggaacagcgc ccggcgctcg aaggtcggat ccgtacgctc       120
     gggcggctcg tgccggatcc ggtgacgggt tgcgaaaggc tgtaccggaa cgggttctcg       180
     tacgccctcg atctctccgg ccggatcctg gcggagtacg agccggacga actcgaccag       240
     gtgaccgccc tcgtcggcgc accgtacgcg gttcacgtgt cgtgccagtc catggaagcg       300
     gcccgaactc ttctccgcga ggtcctcccc ggcgtcgacg gtctcgtgga caccaaccac       360
     ttcgagatcc tgccggtgag cgggttcctc ggtctgctgg cgcggcatcc cgagtgggac       420
     tggcgccgtc gcccgagcac ggagcttccg tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page