(data stored in ACNUC7421 zone)

EMBL: AP009493.PE242

AP009493.PE242       Location/Qualifiers
FT   CDS_pept        complement(258408..258854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_242"
FT                   /product="putative pyridoxamine 5'-phosphate
FT                   oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_242"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17071"
FT                   /db_xref="GOA:B1VNP8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP8"
FT                   /protein_id="BAG17071.1"
FT                   /translation="MTAIFDEAVRARLRAANIWYVGTVFADGAPQVSPMWVDLEGEGEL
FT                   TFNTSVGRVKEENLRRDPRVYLSHADAADPFDRVQISGEVARFVEGAEAHERMDRLARK
FT                   YLGVERFEWTMPGERRVAVIVRPVKVRHIVGVERFRPGGPVPAP"
     atgactgcga tcttcgacga agccgtccgc gcccggctgc gagcagccaa catctggtac        60
     gtcggcaccg tgttcgccga cggagcaccg caggtcagcc cgatgtgggt tgacctggaa       120
     ggagaggggg agctgacgtt caacacctcg gtgggccggg tgaaggagga gaacctgcgc       180
     cgcgaccccc gcgtctatct ctcgcacgcg gacgccgccg atcccttcga ccgggtgcag       240
     atcagcggcg aggtggcccg tttcgtcgag ggcgccgagg cacacgagcg gatggaccgg       300
     ttggcgcgga agtacctggg cgtcgagcgg ttcgagtgga ccatgccggg ggagcgacgg       360
     gtcgcggtga tcgtgcgccc cgtgaaggta cggcacatcg tcggagtgga gcgtttccgg       420
     cccggcggcc ccgtacccgc cccctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page