(data stored in ACNUC7421 zone)

EMBL: AP009493.PE246

AP009493.PE246       Location/Qualifiers
FT   CDS_pept        complement(264078..265604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_246"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_246"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17075"
FT                   /db_xref="GOA:B1VNQ2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNQ2"
FT                   /protein_id="BAG17075.1"
FT                   /translation="MKIPGASAAFGVRTRLVLAFLLVAAVSAVTTAALTYREARSAVLE
FT                   RAQDTAVASFREEVERFVPGLPLDLEAVRWELYDIAARSKPHPWIVFAEYGSTRVSSGD
FT                   RPVSGVLTEDLRRAARTAPHGSFQRVVKDGKAYLTIGMPVMTRVVAGGGAVPSGLILFA
FT                   VMPMTNEETDIDALVTAARDGALPGLAVALVPALFAARSVLRPVRELRRAADSMGGGRL
FT                   DARIAVRGRDEMADLARTFNSSAARLEHSVQELRDAGARARRFASDVSHELRTPLAGML
FT                   AVTDVLDEEAATLDPDTARAVRLISAETGKLAVLVEDLMEMSRFDARAAELTTDEVDAA
FT                   EAVRRSLSGRKWQDRVRAELPEGIRIRLDPRRFDVIVANLVGNALHHGAEPVTVRLSSR
FT                   AGSLITEVRDSGPGIAPDALPHVFDRFYKADAARSRSSGSGLGLAITQENVRLHGGTIR
FT                   AQNAPGGGALFTVELPFDGPASGHGAPDGPATAHGEGPGTGPHTSTEAGA"
     gtgaagatac ccggagcgtc cgccgcgttc ggcgtgcgca cccggttggt gctcgcgttc        60
     ctcctggtcg ccgcggtcag cgcggtcacg acggcggcgt tgacctaccg ggaggcgcgc       120
     agcgcggtcc tcgaacgcgc acaggacacg gccgtcgcct ccttccgcga ggaggtcgag       180
     cggttcgtgc ccggcctgcc cctggacctg gaagcggtcc ggtgggagct gtacgacatc       240
     gcggcccgct ccaaacccca tccctggatc gtgttcgccg agtacggttc gacgcgcgtc       300
     tcctcgggcg accggcccgt ctccggcgtg ctgaccgaag atctgcgccg tgccgcgcgg       360
     accgcgccgc acggcagctt ccaacgggtc gtcaaggacg ggaaggcgta tctcaccatc       420
     ggtatgccgg tgatgacccg ggtcgtcgcg ggcggcggcg cggtgcccag cggtctgatc       480
     ctcttcgccg tgatgcccat gacgaacgag gagacggaca tcgacgcact ggtgaccgcc       540
     gcccgcgacg gtgcgctgcc ggggctggcc gtggcgttgg tacccgccct gttcgccgcg       600
     cgcagcgtgc tgcgccccgt ccgtgaactg cggcgtgccg cggactccat gggcggcggg       660
     cggctcgacg cgcggatcgc cgtgcgcggc agggacgaga tggccgacct cgcccggacg       720
     ttcaacagct ctgcggcgcg tctggaacac tccgtgcagg aactccggga cgccggggcg       780
     cgggcccggc gtttcgcctc ggacgtctcg cacgaactgc gcacccccct cgcggggatg       840
     ctcgccgtca cggacgtgct ggacgaggag gccgcgacgc tcgacccgga caccgcccgg       900
     gcggtgcgcc tgatcagcgc cgagaccggc aaactggccg tgctggtgga ggacctgatg       960
     gagatgtccc gcttcgacgc ccgcgcggcc gaactcacca ccgacgaggt ggacgccgcg      1020
     gaggccgtga ggcgcagcct gtccggcagg aagtggcagg accgggtccg tgccgagctg      1080
     cccgagggca tccggatccg cctcgacccg cgccgcttcg acgtcatcgt ggccaacctc      1140
     gtcggcaacg ccctgcacca cggggccgaa cccgtcacgg tccggctgtc gtcccgcgcg      1200
     ggctcgctga tcaccgaggt gcgcgacagc ggacccggga tcgcccccga cgcgctgccc      1260
     cacgtcttcg accgcttcta caaggcggac gccgcccgct cccgctcgtc gggcagcggc      1320
     ctcggcctcg cgatcaccca ggagaacgtg cgcctccacg gcggcacgat ccgcgcccag      1380
     aacgcgcccg ggggcggtgc gctgttcacg gtggaactgc ccttcgacgg accggcatcg      1440
     ggccacgggg cgcccgacgg tccggcgacc gcacacggcg aagggccggg gaccggccct      1500
     cacaccagca cggaggccgg agcgtga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page