(data stored in ACNUC7421 zone)

EMBL: AP009493.PE25

AP009493.PE25        Location/Qualifiers
FT   CDS_pept        complement(30612..32018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_25t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_25t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16854"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM8"
FT                   /protein_id="BAG16854.1"
FT                   /translation="MFRDHCAVLNTPRDRSCLSEGEVVPRTPNENLRVLVRRSGWSYSQ
FT                   LARAVRLVAAEHERPVLCDHTSVTRWIAGTQPRPPASTFLIEALSRKLGRRITAQQAGL
FT                   TRAPETSLILSWQDDPLFRLGLLVEFELDPARVHLLEAGTYRPSALSPPDPWGPLGSTV
FT                   TAPAPATGRIGGAEADQLRSMTQMFGASIAQHGGQAMRAALAAYLAHTVTPWLHGPASD
FT                   STHREVLSYGAQLTLLLADACIDADGHVATQHYQQLAARLAADAGDHATVAIALRAMAT
FT                   HASSLGHRGPAVLHLTQRAVEHARHAPPAVRSYAYAHLAVVQAHHNRRAALDALASAER
FT                   IHPERADTPPGPFTSYPKGALHYQRAQTLDALKDTPGALRALNASLHARTPGEHRAALL
FT                   THARLAEMLLRHGHLERALAQWYIFVDEYPTLRSPRTHRLLAVMQGQLRHHIRHAGARV
FT                   LLARAETLLR"
     atgttccggg accactgcgc cgtcctgaac acccccaggg acaggagctg tctttcggaa        60
     ggagaggtcg tgcctcgcac acccaacgag aatctgcgcg tcctcgtgcg acgcagcggc       120
     tggagctatt cacaactggc cagagcggta cggctggtgg cggccgagca cgagagacct       180
     gttctgtgcg accacacctc ggtgacgcgg tggatcgccg ggactcagcc ccgccccccc       240
     gcgtccacgt tcctcatcga agcactctcg cggaaactgg gccgccggat cacggcccag       300
     caggccggac tcacccgtgc ccccgagacc tcgctcatcc tgtcctggca ggacgaccca       360
     ctgttccgcc tcggtctgct cgtcgagttc gaactcgacc cggcccgcgt ccacctgctc       420
     gaagctggga cgtaccgccc cagcgcccta tcgcctcccg atccctgggg gccgctcggc       480
     tcaacggtga cagccccggc cccggcgacc ggtcgcatcg gcggcgcgga ggctgaccaa       540
     ctccgctcca tgacacagat gttcggcgct agtatcgccc agcacggcgg ccaggcgatg       600
     cgggcggcac tcgccgcgta cctggcacac accgtcactc cctggctgca tggccccgcc       660
     tcggacagta ctcaccgtga agtgctgtct tacggggccc agttgacgct cctacttgcc       720
     gacgcctgca tcgacgcgga cggtcacgtc gcaacccagc actaccagca gctggccgcc       780
     cgcctcgccg ccgacgcggg cgaccacgcg accgtggcca tagccctgcg ggcgatggcc       840
     acacacgcct ccagcctggg ccaccggggt cccgccgtcc tgcacctcac ccagcgggcc       900
     gttgagcacg cccgccacgc cccgcccgcc gtccgcagct acgcgtacgc tcatctcgcg       960
     gtcgtccagg cccaccacaa ccgtcgcgcc gcactggacg cgctcgccag cgctgaacga      1020
     atccatcctg aaagggccga cacccctcct ggccccttca ccagctaccc gaagggtgct      1080
     ctgcactacc aacgggcaca gacgctcgac gcgctaaagg acacacctgg tgcgttgcgc      1140
     gccctgaatg cctcgctcca cgctcggaca cctggcgaac accgcgcggc actactcacc      1200
     cacgcacgcc tcgccgagat gcttcttcgc cacggccatc tcgagcgggc cctggcacag      1260
     tggtacatct tcgtcgacga gtaccccact ctccggtccc cccgtacaca ccgcctgctg      1320
     gcagtcatgc aggggcaatt gcgccaccat attcgacacg cgggagcgcg ggtcctcctc      1380
     gcacgcgccg agacgctcct gcgctga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page