(data stored in ACNUC7421 zone)

EMBL: AP009493.PE250

AP009493.PE250       Location/Qualifiers
FT   CDS_pept        complement(268039..270015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17079"
FT                   /db_xref="GOA:B1VNQ6"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNQ6"
FT                   /protein_id="BAG17079.1"
FT                   /translation="MESAKGRPRVPLRDWARYRFDRTLARSTGTLMGWLVITCLAVVVP
FT                   VSLLLVWTDPGSPASLSGRLIATWRMSAETLRLGAATGTPPRLVLSAVLGLVALLCVST
FT                   LVGVITTGLAERMAELSRGRSTVLEQGHVLVLGWSDQVTTVVGELVAARAPRRPRAIVL
FT                   LADRDKSEMEEALTARGGPASRARIICRSGPASDPEVLARVSPRSASTVVVLPSNGPTA
FT                   DAEVLRVLLGLRAVLGEGTDGPPVLAAIRDDRYRAPARLAAGPRGTVLETDTVTARLIA
FT                   QCVGRPGLSLVLRDLLDFAGDEFHLADSTAFHHGPFGPTLLSHPHSCVVGLLTPEGRTL
FT                   LNPPADTAVLPGSRLIVLARDDDSTRVEDCRHLVDAAVIAPARPEPDDPSRLLLLGWNR
FT                   RAPLVLDQLRSTARTGSSVEVVADSAVPGPRGTEDRQPAGRDVRFRQAPLSRPETLLGL
FT                   DLDRYDAVVVLGPDRGDGPDHPDDWTLVALLAVRLLDGRTGRETRVVTELVDDRNRPLA
FT                   PVNSGSDVIVSGMLIGLLMAQIAQNRHLAAVFEELLSAEGNTVCLRPAGAYIRPGAEAT
FT                   FAGVVAAARDRGECAIGYRRHDITRTGTGDQGIRLNPPKGERRVWYAEDQVVVIATDHH
FT                   GPPAPAAGPDASDTADSAPSGAR"
     gtggaatcag ccaagggccg gccgcgggtg ccgttgcggg actgggcacg ctaccggttc        60
     gaccgtacgc tggcccgctc gaccggcacc ctgatgggct ggctggtgat cacctgcctg       120
     gccgtcgtgg tcccggtcag cctgctgctc gtgtggacgg atcccggttc gcccgcgtcc       180
     ctctcggggc ggctgatcgc gacctggcgg atgagcgcgg agacgctgcg tcttggagcg       240
     gccaccggta cgccgccgcg tctggtgctc tccgctgtgc tcgggctggt cgcgctgctc       300
     tgcgtatcga ctctggtcgg ggtgatcacg accggactgg ccgagcggat ggcggagttg       360
     agcaggggac ggtccaccgt ccttgagcag gggcacgtcc tggtgctggg ctggtcggac       420
     caggtgacca ccgtggtggg tgaactggtc gccgcccggg ccccgcgccg gccgcgcgcc       480
     atcgtgctgc tcgccgaccg cgacaagagc gagatggagg aggcgctgac cgcgcggggc       540
     ggtccggctt cccgcgcccg gatcatctgc cgcagcggcc ccgccagtga cccggaggtc       600
     ctggcacgcg tcagcccgcg atcggcgagc accgtggtgg tgctgccgtc gaacggaccg       660
     acggccgacg cggaggtgct gcgcgtcctg ctgggcctgc gggcggtcct cggcgagggc       720
     acggacgggc cgccggtgct cgccgcgatc cgcgacgacc gctaccgggc cccggcccgg       780
     ctggccgcgg gcccccgcgg cacggtcctg gagaccgaca cggtcacggc ccggctgatc       840
     gcgcagtgcg tcggccgccc ggggctctcc ctcgtcctgc gcgacctgct cgacttcgcg       900
     ggcgacgagt tccatctcgc cgactccacg gcgttccacc acggcccctt cggcccgacc       960
     ctgctgagcc acccgcactc ctgcgtggtg gggctgctca cgcccgaggg ccgaacgctg      1020
     ctgaacccgc ctgccgacac cgccgtcctg cccggaagcc ggttgatcgt gctcgcccgc      1080
     gatgacgaca gcacccgggt cgaggactgc cgccatctcg tcgacgccgc ggtgatcgcc      1140
     ccagcccggc ccgagccgga cgatccttcg cggctgctgc tgctcggctg gaaccgccgg      1200
     gcccccctgg tcctggacca gttacggagc acggctcgca ccggctcctc cgtggaggtg      1260
     gtcgccgaca gcgccgtacc cggaccgaga ggaacggagg accggcaacc ggccggtcgc      1320
     gacgtgcgct tcaggcaggc ccccctgtca cggcccgaga ccctgctcgg cctcgacctc      1380
     gaccggtacg acgcggtggt cgtcctgggc ccggaccggg gcgacggccc cgaccacccg      1440
     gacgactgga ccctggtcgc gctgctggcc gtgcgcctgc tggacgggcg aaccggacgc      1500
     gagacgcggg tcgtcaccga gctcgtcgac gaccggaacc ggcccctggc accggtgaac      1560
     agcggctccg acgtcatcgt cagcgggatg ctgatcggcc tcctcatggc tcagatcgcc      1620
     cagaaccggc atctggcggc cgtcttcgag gagttgctct ccgccgaggg caacaccgtc      1680
     tgtctgcggc ccgccggcgc ctacatccgc ccgggagccg aggccacgtt cgccggcgtc      1740
     gtcgccgccg cgcgggaccg gggcgaatgc gcgatcggct accgccggca cgacatcacc      1800
     cgcaccggga ccggggacca gggcatcagg ctcaacccgc cgaagggcga acggcgcgtc      1860
     tggtacgccg aggaccaggt ggtggtcatc gcgacggacc accacggccc gcccgcaccc      1920
     gccgccggac cggacgcgtc cgacacagcg gactccgcac cctcgggagc ccgttag         1977
//

If you have problems or comments...

PBIL Back to PBIL home page