(data stored in ACNUC7421 zone)

EMBL: AP009493.PE255

AP009493.PE255       Location/Qualifiers
FT   CDS_pept        273647..274192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_255"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17084"
FT                   /db_xref="GOA:B1VNR1"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR1"
FT                   /protein_id="BAG17084.1"
FT                   /translation="MGGRVTAVSRNERYGFSKPTRPSITLLAGLGVEGDVHAGTTIRHQ
FT                   FRMTYEPDLPNLRQVHLMHEELFEELALKGFDVSAGRLGENVTTAGVDLLGLPAGTLLH
FT                   LGKEAVLEVTGLRNPCAKINDFRPGLLGEVFALDPVSGEFTFKSGVMAVVRTGGTVRAG
FT                   DTVEVELPPPPHRALERV"
     atgggcggcc gggtcaccgc ggtcagccgc aacgagcggt acgggttcag caaacccacc        60
     cgcccgtcca tcacgctgct cgccgggctc ggcgtggagg gggatgtgca cgcgggaacg       120
     acgatccgcc accagttccg catgacgtac gaaccggacc tgcccaacct gcgccaggtc       180
     cacctgatgc acgaagaact cttcgaggag ctcgcgctca agggcttcga cgtgtcggcg       240
     ggccggctcg gcgagaacgt caccaccgcg ggggtggacc tcctcgggct tcccgccggc       300
     accctgctgc acctcgggaa ggaggcggtc ctggaggtga ccgggctgcg caatccgtgc       360
     gcgaagatca acgacttccg cccggggctg ctgggcgagg tgttcgccct ggaccccgtg       420
     tcgggagagt tcaccttcaa gtcgggcgtc atggccgtgg tccgcaccgg ggggacggta       480
     cgcgccggcg acaccgtcga ggtcgagctg ccgccgcccc cgcaccgggc cctggaacgc       540
     gtctag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page