(data stored in ACNUC7421 zone)

EMBL: AP009493.PE258

AP009493.PE258       Location/Qualifiers
FT   CDS_pept        complement(275486..276595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_258"
FT                   /product="putative amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_258"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17087"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR4"
FT                   /protein_id="BAG17087.1"
FT                   /translation="MNTPPSPSGAEHTDRSPVRLGALVPLTRPGWVEAGRHLLAGLDLA
FT                   VGEVNDAGGIDGRPLELVVRDTAADPERAAAAVDELAHLGVAAVAGEYHSVVARAAAAR
FT                   ADALGVPFLCSSAVLDALTEEPTEWVARLAPAQSHGWRIYADFLLRTGRSRIAVVTQPS
FT                   VYWASGTRVLRDHLAARGGTVLELDATLTPEALCDALVDHGATALLLLVGHPEPAVPIV
FT                   RAVRGDRRLAEILLGAPAGQPEFAEWAAALGDDGAGIPFLRYLPERLGPLGERVGKELR
FT                   ERLGEAPSFVAFEGWDTVAVLAGLLRSHGTDRAALAGSWPRVAVEGTRGPIRFSRTPGI
FT                   SVWQWAWTPIHVVDRDPAEPDRFRILHAG"
     atgaacacgc caccatcgcc gtccggagcg gagcacacgg acaggtcacc cgtccgcctg        60
     ggcgctctgg ttccgctgac gcggcccggc tgggtcgagg cgggccgaca cctgctcgca       120
     ggactcgacc tggccgttgg tgaggtcaac gacgccggcg ggatcgacgg cagaccactg       180
     gagttggtgg ttcgggacac cgcggccgat ccggagcggg ctgccgcggc cgtggacgaa       240
     ctggcccacc tgggcgtggc cgccgtggcg ggtgagtatc acagcgtggt cgcccgcgcc       300
     gccgccgccc gagccgacgc cctcggcgta ccgtttctct gctcgtccgc ggtgctcgac       360
     gcgctcaccg aggagccgac ggagtgggtc gcgcgtctgg ccccggccca gtcccacggc       420
     tggcggatct acgcggactt cctcctccgc acgggccgga gtcggatcgc cgtggtgacc       480
     cagccgagcg tctactgggc gtccgggacc cgcgtcctgc gggaccacct cgctgcccgc       540
     ggcggcaccg tcctcgaact cgacgcgacg ctcacgcccg aggccctgtg cgacgcgctc       600
     gtcgaccatg gcgcgacagc gctgctcctg ctggtcggcc atccggagcc ggcggtgccc       660
     atcgtccggg ccgtccgggg tgaccggcgg ctcgcggaga tccttctcgg cgctccggcc       720
     ggacaaccgg agttcgccga atgggccgcg gcgctgggcg atgacggcgc cgggatcccg       780
     ttcctgcgct acctgcccga gcgcctcggt ccgctcggtg aacgcgtcgg gaaggagctc       840
     cgcgagcggc tcggcgaagc gccctccttc gtcgccttcg aggggtggga caccgtcgcc       900
     gtcctcgcgg gattgctgcg ttcccacggc acggaccggg cggccctcgc cgggtcatgg       960
     ccgcgcgtcg cggtcgaggg cacccgcggg ccgatccggt tctcccgcac gccgggcatc      1020
     agcgtctggc aatgggcttg gacacccatc cacgtcgttg accgggaccc ggcggaaccc      1080
     gatcgctttc ggatcctcca cgccggctga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page