(data stored in ACNUC7421 zone)

EMBL: AP009493.PE260

AP009493.PE260       Location/Qualifiers
FT   CDS_pept        278779..279135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17089"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR6"
FT                   /protein_id="BAG17089.1"
FT                   /translation="MRCREILAFCAGIAVLLLISVFTLGSSTQTPGTVDTSTHSHSVSV
FT                   FDGSGPSAPLEGVDGDATLQHRHKAGSATASPPVPAGIPSTSPDLHDCAADAARQHAAH
FT                   PGSRSPARVQILRC"
     atgcgctgca gggagattct ggccttctgt gccggtatcg ccgtgctcct gctgatttcc        60
     gtgttcaccc tcggttcctc cacccagacc ccggggaccg tcgacacgtc gactcattcc       120
     cactccgttt ccgtattcga cgggtcgggg ccgagcgctc cgctggaggg cgtcgacggt       180
     gacgccacgc tccagcaccg ccacaaagcg ggaagcgcta cggcctctcc tcccgtgccg       240
     gcgggcattc cctccacctc acctgatctc cacgactgcg cggcggatgc cgcccggcag       300
     catgctgcgc acccgggttc gcgaagccct gcccgtgtcc agatccttcg ctgctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page