(data stored in ACNUC7421 zone)

EMBL: AP009493.PE261

AP009493.PE261       Location/Qualifiers
FT   CDS_pept        279468..280124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_261"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17090"
FT                   /db_xref="GOA:B1VNR7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR7"
FT                   /protein_id="BAG17090.1"
FT                   /translation="MQHFPLASEQASGIAGWATSLVETMGGPGAGLAIALENLFPPLPS
FT                   EIILPLTGFAAGQGVISLFSALFWTTLGSVVGAVALYQIGALFGRDRMYALWERLPLVK
FT                   VSDLRKTEAWFVKHGMKAIFFGRMIPIFRSLISVPAGLERMPLPIFILLTALGSFIWNF
FT                   ILVMAGYLLGDQWELVESYVGVLSKVVLVLVVVALVVAVARRLRSRRGDRQRGHA"
     atgcagcatt tccccctcgc ctcggagcag gcgagcggca tcgcagggtg ggcgaccagc        60
     cttgtcgaaa ccatgggtgg ccccggggcc gggctggcga tcgccttgga gaatctcttt       120
     ccgccgctgc cgagcgaaat cattctgccg ctgacgggtt tcgccgcggg gcagggagtg       180
     atcagcctgt tctccgcgct gttctggacg acgctggggt cggtggtagg ggctgtcgcc       240
     ctctatcaga tcggcgctct cttcggccgg gaccgcatgt acgcgctgtg ggagcggctt       300
     cccctggtga aggtctccga tctcaggaag accgaggcct ggttcgtcaa gcacggcatg       360
     aaggccatct tcttcggccg gatgattccg atcttccgca gcctgatcag tgttccggca       420
     ggcctggagc gcatgccgct gccgatcttc atactcctca ccgctctggg cagcttcata       480
     tggaacttca tcctcgtcat ggccggatac ctgctgggtg accagtggga gctcgtggag       540
     agttacgtcg gagtgctctc gaaggtcgtt ctggttctgg tggtcgtggc gttggtcgtg       600
     gcggtcgctc gcaggctgcg ttcccgtcga ggtgaccggc agaggggcca cgcgtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page