(data stored in ACNUC7421 zone)

EMBL: AP009493.PE262

AP009493.PE262       Location/Qualifiers
FT   CDS_pept        280270..280821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_262"
FT                   /product="putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_262"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17091"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNR8"
FT                   /protein_id="BAG17091.1"
FT                   /translation="MAMWDRIKDQAKGLQQQSQGTRGPAGQGQPGTGSSGGSKEKLVGL
FT                   LKSQLGSLKTELKSGAYRDASMAMCALVAAADGSVDPAERHHVETLILQNDVLQNFPPE
FT                   QLRQRFNKHVDQMMFNFQQGKTEAMQEIAKAAKKPVEAKAVVQTGFVIAGADGYIAPAE
FT                   AQVLREACMALGVSPQEFGL"
     atggctatgt gggaccgcat caaggaccag gccaaggggc ttcagcagca gtcgcagggc        60
     acgaggggcc cggccggcca gggacagccg ggcaccggat cctccggcgg ctcgaaggag       120
     aagttggtgg ggctgctcaa gtcgcagctc ggctccctca agacggagct caagagtggg       180
     gcgtaccggg acgcgagtat ggcgatgtgt gctctggtcg cggccgccga cgggtccgtc       240
     gaccccgccg agcggcacca cgtggagacg ctgatcctgc agaacgacgt cctgcagaac       300
     ttccctccgg agcagctgcg gcagaggttc aacaagcatg tcgatcagat gatgttcaac       360
     ttccagcagg gcaagacgga ggccatgcag gagatcgcca aggccgcgaa gaagcccgtg       420
     gaggccaagg ccgtcgttca gaccggcttc gtgatcgccg gtgcggacgg gtacatcgcc       480
     ccggcagagg cgcaggtcct ccgggaggcg tgcatggcgc tcggggtgtc cccgcaggag       540
     ttcgggctct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page