(data stored in ACNUC7421 zone)

EMBL: AP009493.PE265

AP009493.PE265       Location/Qualifiers
FT   CDS_pept        complement(282684..283175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_265"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17094"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS1"
FT                   /protein_id="BAG17094.1"
FT                   /translation="MDPLTEQDIRTSFVNCTKGEAKRLSVPRDLLDRPWGDLDFLGWRD
FT                   PQAPDRAYLVLGSGEGPVGIQLRSSDAGSWQTRRSMCSLCVTVHTGGVSLLVAPRAGKA
FT                   GQQGNSVGAYMCTDLACSLYVRGKKDAGVGSRLRESLTLEQQIERTVMNVEAFIARVTG
FT                   "
     atggaccccc tgaccgaaca agacatccgt acgtccttcg tgaactgcac caagggcgag        60
     gccaagcgcc tgtccgtgcc ccgcgacctc ctcgaccgcc cctggggcga cctggacttc       120
     ctgggctggc gcgacccgca ggcccccgac cgggcctatc tcgtgctcgg ctcgggcgag       180
     ggccccgtcg gcatccagtt gcgctcctcc gacgccggat cctggcagac ccgccgcagc       240
     atgtgttcgc tgtgcgtgac cgtccacacc ggaggcgtct ccctgctcgt ggcccccagg       300
     gccgggaaag cgggacagca gggcaactcg gtcggcgcct acatgtgcac cgacctcgcc       360
     tgctcgctct acgtgcgcgg gaagaaggac gcgggcgtcg ggtcacggct ccgcgagtcc       420
     ctcaccctgg agcagcagat cgagcgaacc gtgatgaacg tcgaggcgtt catcgccagg       480
     gtgaccggat ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page