(data stored in ACNUC7421 zone)

EMBL: AP009493.PE267

AP009493.PE267       Location/Qualifiers
FT   CDS_pept        283905..285089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_267"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17096"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS3"
FT                   /protein_id="BAG17096.1"
FT                   /translation="MTTRHDWTTTPISADIVRGALDLERTGRGTLPHRLPAGARRQIPD
FT                   DQLAMAASQPSGVRLAFRTRATAVELDVVATKRVYPGAPPRPDGVYELLVDGRPTARAS
FT                   APDGDTLTVDLASMTSRTRPGPVETLRFTGLPDEDKDVEIWLPHDETTLLVALRTDAPL
FT                   RSPAPSGRPVWLHHGSSISHGSNATTPTGTWPALAAGLGGADLINLGFSGSALLDPFTA
FT                   RAMRDTPADLISVKIGINLVNADLMRLRAFGPAVHGFLDTLREGHPTAPLLVVSPICCP
FT                   IHETTPGPCAPDRSAMGEGRLRFVAMGDPAETAAGKLTLTVIREQLARIVAERAADDPH
FT                   LHYLDGLDLYGASDHAELPLPDDLHPDPAAHRRIAERFARHAFGHDGPFTPKHR"
     atgaccaccc ggcacgactg gacgaccacc cccatcagcg ccgacatcgt ccggggcgcg        60
     ctcgacctgg agcggaccgg gcgcggcacg ctgccgcacc ggctgcccgc gggggcacgg       120
     cggcagatcc ccgacgacca gttggccatg gccgcatcgc agccctccgg ggtccggctg       180
     gcgttccgca cccgggccac cgccgtcgaa ctggacgtgg tggcgaccaa gcgggtctat       240
     cccggtgcgc cgccgcgccc cgacggggtg tacgaactcc tcgtggacgg ccgccccacc       300
     gcccgggcca gtgcccccga cggtgacacg ctcaccgtcg atctggcctc gatgacctcg       360
     cggacccggc ccggccccgt ggaaacgctc cggttcaccg gactgccgga cgaggacaag       420
     gacgtcgaga tctggctgcc gcacgacgag accacgctcc tggtcgccct gcgcaccgac       480
     gcgccgctca ggagccccgc cccgagcggc cggccggtct ggctgcacca cggcagctcc       540
     atcagccacg ggtccaacgc caccaccccc accggcacct ggcccgccct ggccgccggc       600
     ctcggcggag ccgatctgat caacctgggg ttcagcggca gcgccctgct cgatccgttc       660
     accgcccgag ccatgcgcga caccccggcc gacctgatca gcgtcaagat cggcatcaac       720
     ctcgtcaacg ccgacctgat gcggttgcgc gcgttcggcc cggcggtcca cggcttcctc       780
     gacaccctcc gcgaaggcca ccccaccgca ccgctgctcg tggtctcgcc gatctgctgc       840
     cccatccacg agaccacgcc gggcccctgc gccccggacc ggagcgcgat gggcgagggg       900
     cggctgcggt tcgtcgccat gggcgacccc gcggagaccg ccgccggaaa gctgaccctc       960
     accgtcatcc gcgagcaact cgcccggatc gtcgccgaac gcgcggccga cgacccccat      1020
     ctgcactacc tcgacggtct cgacctgtac ggcgcgagcg accacgcgga actcccgctc      1080
     cccgacgacc tgcacccgga ccccgccgcc caccggcgca tcgccgaacg cttcgcccgc      1140
     cacgccttcg gccacgacgg ccccttcacg ccgaagcacc gctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page