(data stored in ACNUC7421 zone)

EMBL: AP009493.PE269

AP009493.PE269       Location/Qualifiers
FT   CDS_pept        286065..286955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_269"
FT                   /product="putative Sir2-family regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_269"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17098"
FT                   /db_xref="GOA:B1VNS5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS5"
FT                   /protein_id="BAG17098.1"
FT                   /translation="MRMRPTLSWTSAEEPLPGTTDLEPVVEALRGGGVLVLSGAGISTE
FT                   SGIPDYRGEGGSLSRHTPMTYQDFTADAGARRRYWARSHLGWRTFGRARPNAGHRAVAA
FT                   FGRRGLLSGVITQNVDGLHQAAGSADVVDLHGRLDRVVCLSCGAFGPRSELARRLEEAN
FT                   EGFAPVAAAMNPDGDADLTDEQVGDFRVVPCAVCGGVLKPDVVFFGESVPPRRVEHCRA
FT                   LVDAASALLVLGSSLTVMSGLRFVRQAERSGLPVLIVNRDPTRGDRHALPRIALPLGDA
FT                   LTTAAGRLGVRVDDD"
     atgcgcatgc gacccaccct gagctggacc tccgccgagg agccgctgcc gggcaccacg        60
     gacctggagc cggtcgtcga ggcgctgcgc ggcggcggtg tgctggtcct gagcggtgcc       120
     ggcatctcca cggagtcggg catccccgac taccggggcg agggcgggag cctgagccgc       180
     cacaccccga tgacctacca ggacttcacc gccgacgccg gggcccgtcg caggtactgg       240
     gcgcgcagcc atctcggctg gcgtacgttc ggccgcgccc ggcccaacgc cgggcaccgg       300
     gccgtggccg cgttcgggcg gcgggggctg ctctcgggtg tgatcaccca gaacgtcgac       360
     ggcctgcacc aggccgccgg cagcgcggac gtcgtggacc tccatggccg gctggaccgg       420
     gtcgtctgcc tgtcctgcgg cgccttcggc ccgcgctccg agctggcgcg caggctggag       480
     gaggccaacg agggcttcgc gccggtggcc gcggcgatga acccggacgg ggacgccgac       540
     ctcacggacg agcaggtcgg ggacttccgc gtggtgccct gcgcggtctg tggcggcgtg       600
     ctcaaaccgg acgtggtgtt cttcggcgag tcggtgcccc cgcgacgggt cgagcactgc       660
     cgcgcgctgg tcgacgcggc gagcgccctg ctggtcctgg gctcctcgct gacggtgatg       720
     tccgggctcc ggttcgtccg gcaggccgaa cgttcgggac tgccggtgct gatcgtcaac       780
     agggacccga cccggggtga ccggcacgct ctgccccgta tcgccctccc gctgggcgac       840
     gccctcacca ccgcggccgg ccgactgggc gtccgggtcg acgacgactg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page