(data stored in ACNUC7421 zone)

EMBL: AP009493.PE270

AP009493.PE270       Location/Qualifiers
FT   CDS_pept        complement(286993..288015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_270"
FT                   /product="putative iron uptake ABC transporter iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17099"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS6"
FT                   /protein_id="BAG17099.1"
FT                   /translation="MPNPLRPAALAFAAALALTGCGADVTSQADGRTGESGADRHYPVT
FT                   VENCGEEKTYDKAPQRVVTNDTGITEIMFALGLEDHMAGYVMPDDKGDRTSVPWKDGYE
FT                   KTKWLSKERINKELVLDARADLVFAGWNYGFNEGEGFTPAELERVGIDSYLLSESCRNG
FT                   QGKARGVMPPLEALYTDLRNLGRIFDVEDRADTLITSFRQEVAEARAKAAEGDDRLRVF
FT                   LYDDGKDKPLTSGAYAGPHDIITKAGGDHIMKDLKDSWTTVGWETVVDRDPEVIVINNY
FT                   GDTGADEKRRFLKSYKPLAGVSAIRNDRIVVLDYVDLVESPRNPAAISSLAEDLREFAR
FT                   "
     atgcccaacc ccctgcgccc cgcggccctc gcgttcgcgg ccgccctggc cctcaccggc        60
     tgcggagcgg acgtcacctc acaggccgac gggaggaccg gcgagtccgg ggccgaccgc       120
     cactacccgg tgaccgtcga gaactgcggg gaggagaaga cgtacgacaa ggccccgcaa       180
     cgcgtcgtca ccaacgacac cggcatcacc gagatcatgt tcgccctcgg gctcgaggac       240
     cacatggccg gatacgtgat gcccgacgac aagggcgacc ggacgtccgt cccgtggaag       300
     gacggctacg agaagaccaa gtggctctcc aaggagcgga tcaacaagga actggtcctc       360
     gacgcccgcg ccgacctggt cttcgccggc tggaactacg gattcaacga gggcgaggga       420
     ttcacccccg ccgaactgga gcgggtgggc atcgactcgt acctgctcag cgagtcgtgc       480
     cgcaacggcc agggcaaggc ccggggcgtc atgcccccgc tcgaagcgct ctacaccgac       540
     ctgcggaacc tcggcaggat cttcgacgtc gaggaccggg cggacaccct catcacgtcg       600
     ttccgccagg aggtggccga ggcgcgggcg aaggcggccg agggcgacga ccgcctccgc       660
     gtcttcctgt acgacgacgg gaaggacaag ccgctgacct cgggggcgta cgccggaccg       720
     cacgacatca tcaccaaggc cggcggcgac cacatcatga aggacctcaa ggacagctgg       780
     acgacggtgg gctgggagac cgtggtcgac cgcgaccccg aggtcatcgt catcaacaac       840
     tacggcgaca ccggagcgga cgagaagcgg aggttcctga agtcctacaa gccgctcgcc       900
     ggggtgtccg cgatccggaa cgaccggatc gtcgtcctgg actacgtgga cctggtcgag       960
     agcccgcgca accccgcggc catcagctcg ctggcggagg acctgaggga gttcgcccgg      1020
     tag                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page