(data stored in ACNUC7421 zone)

EMBL: AP009493.PE271

AP009493.PE271       Location/Qualifiers
FT   CDS_pept        complement(288032..288814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_271"
FT                   /product="putative iron uptake ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_271"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17100"
FT                   /db_xref="GOA:B1VNS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS7"
FT                   /protein_id="BAG17100.1"
FT                   /translation="MRIDIDALTVEIAGARLVDQVTLGAADGQLVGLVGPNGSGKSTLL
FT                   RCVYRALRPSAGAVRIGGEDLHSLTTREGARRLAALPQDAVAEFDFTVAEIVAMGRLPH
FT                   QGPVARASDEDRRLCHEALAGVGAGHLAERGFLTLSGGERQRVLIARALAQQPRVLVLD
FT                   EPTNHLDIAHQLEVLALVRGSGLTVLTALHDLNLAALHCDLVHVIDGGRIVASGAPHTV
FT                   LTTELLADVFGVRAHRVAHPETGALQLIFDLPPARPTS"
     atgcggatcg acatcgacgc gttgaccgtg gagatcgccg gcgcacggct ggtggaccag        60
     gtcaccctgg gcgcggccga cggacagctc gtcgggctgg tcggcccgaa cggcagcggg       120
     aaatcgaccc tgttgcgctg tgtctaccgg gccctgcgcc cctcggccgg cgctgtgagg       180
     atcggcggtg aggacctgca ctccctgacc acccgggaag gcgcccgacg gctggcggcc       240
     cttccccagg acgcggtcgc cgaattcgac ttcaccgtcg ccgagatcgt cgccatgggc       300
     cggctgccgc accaggggcc ggtggcccgg gcgtccgacg aggaccgccg cctctgccac       360
     gaggcgctgg cgggggtcgg cgcgggacac ctcgccgaac gcggcttcct caccctctcc       420
     ggcggggaac ggcagcgtgt tctgatcgcc cgcgccctcg cccagcagcc ccgggtgctg       480
     gtgctcgacg aacccaccaa ccatctggac atcgcgcacc agttggaggt cctcgccctg       540
     gtccgcggca gcggcctcac cgtgctcacc gccctgcacg acctgaacct ggcggccctg       600
     cactgcgacc tggtccatgt catcgacggc ggccggatcg tcgcctccgg ggccccgcac       660
     acggtcctga ccaccgagct gctggccgac gtcttcggcg tacgggcgca ccgcgtcgcc       720
     catccggaga ccggagcgct ccaactgatc ttcgaccttc cccccgcccg ccccacctcc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page