(data stored in ACNUC7421 zone)

EMBL: AP009493.PE272

AP009493.PE272       Location/Qualifiers
FT   CDS_pept        complement(288814..289923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_272"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_272"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17101"
FT                   /db_xref="GOA:B1VNS8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS8"
FT                   /protein_id="BAG17101.1"
FT                   /translation="MATSVDRIPSKPSRPAHDGTGPAPPRRVPLPILLACLCAALPLSL
FT                   VCGAALGASGLSWAQVTRYLWAGLTGGAIGPDEVPAYTIVWELRLPRAVLAAVVGAGLS
FT                   AIGVAVQAMVRNALADPFVLGISSGAAVGANAVLIFGALGALGIWALSTAAFLSALLAM
FT                   LLVYAVARTERGLTPLRLVLTGTAMYYGFSAVTTFMVFAAERGEAARSAMMWLLGSLSG
FT                   ANWAAVPIAAGAVLAGLAHLGWSARRLNALALGDETAAALGVDAGRLRKELFLVSAAVT
FT                   GAVVAVSGAIGFVGLMVPHAARMLVGADHRRLLAVAPLAGAVLLIWVDILSRVVLAPAE
FT                   LPVGVLTAVIGVPCFILLMRRRAYSFGGI"
     gtggccacgt ctgtcgaccg cataccctcc aagccgtcac gcccggcgca cgacggcacc        60
     ggaccggcgc caccgcggcg cgtacccctg ccgatactcc tggcgtgcct gtgcgcggcc       120
     ctgcccctct ccctcgtctg cggggcggcg ctcggcgcct cgggactctc ctgggcccag       180
     gtgacgcgct acctgtgggc aggactgacc ggtggggcca tcggccccga cgaggtccct       240
     gcctacacca tcgtctggga actgcgcctg ccacgggccg tgctggcggc cgtcgtcggc       300
     gcgggcctgt ccgccatcgg cgtggccgtc caggccatgg tgcgcaacgc gctggccgac       360
     ccgttcgtcc tcgggatctc ctcgggcgcg gcggtcggcg ccaacgccgt actcatcttc       420
     ggggccctgg gcgcactggg catctgggcc ctgtcgacgg cggcgttcct ctccgcactg       480
     ctcgccatgc tgctcgtgta cgcggtcgcc cgcaccgaac gcggactgac ccccctccgg       540
     ctcgtcctga cggggaccgc gatgtactac gggttctccg ccgtcaccac gttcatggtg       600
     ttcgcggccg agcgcgggga agcggcccgg tccgcgatga tgtggctgct cggcagcctg       660
     agcggggcca actgggccgc cgtgccgatc gccgccggag cggtcctcgc cggcctcgcc       720
     cacctcggct ggtcggcacg gcgcctcaac gccctcgccc tcggggacga gaccgccgcc       780
     gccctcgggg tcgacgccgg gaggctgcgc aaggaactct tcctcgtctc cgccgccgtc       840
     acgggggcgg tcgtcgcggt gagcggagcg atcggcttcg tcggcctgat ggtcccgcac       900
     gccgcccgga tgctggtcgg cgcggaccac cgccggctcc tggccgtcgc ccccctggcg       960
     ggagccgtcc tgctgatctg ggtggacatc ctgtcgcgcg tggtgctggc gccggccgag      1020
     ctgccggtgg gggtcctcac cgcggtcatc ggcgttccct gcttcatcct cctcatgcgg      1080
     cggcgcgcct actccttcgg aggcatctga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page